You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00072
Secondary Accession Numbers None
Name 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-1
Synonyms Not Available
Gene Name PLCB1
Protein Type Enzyme
Biological Properties
General Function Cell cycle control, cell division, chromosome partitioning
Specific Function The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes.
Pathways
  • Activation of PKC Through G Protein-Coupled Receptor
  • Cadmium Induces DNA Synthesis and Proliferation in Macrophages
  • G-Protein Signaling Through Tubby Proteins
  • GnRH Signaling Pathway
  • Histamine H1 Receptor Activation
  • Muscle/Heart Contraction
  • Phosphatidylinositol Phosphate Metabolism
  • Phospholipase C Signaling Pathway
  • Phospholipase C Signaling Pathway
  • Succinate Signalling During Inflammation
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 13
Locus Not Available
SNPs PLCB1
Gene Sequence
>3651 bp
ATGGCCGGGGCACAGCCTGGAGTGCACGCGCTGCAACTCAAGCCGGTGTGCGTGTCCGAC
AGCCTCAAGAAGGGCACCAAATTCGTCAAGTGGGAGGATGACTCCACTGTTGTCACTCCG
ATTATTTTGAGGACTGACCCTCAGGGATTTTTCTTTTACTGGACAGATCAAAACAAGGAG
ACGGAGCTGTTAGATCTCAGCCTTGTCAAAGACGCCAGATGTGGGAAACATGCCAAGGCG
CCCAAGGACCCTAAATTACGTGAACTTCTGGATGTGGGGAACATTGGGCGCCTGGAACAT
CGCATGATCACAGTGGTGTATGGGCCTGACTTAGTGAACATCTCCCATTTGAACCTCGTG
GCTTTCCAAGAAGAAGTGGCCAAGGAATGGACAAATGAGGTTTTCAGTTTGGCAACAAAC
CTGCTGGCCCAAAACATGTCCAGGGATGCATTTCTGGAAAAGGCGTATACTAAGCTTAAG
CTGCAAGTCACTCCAGAAGGACGCATTCCTCTCAAAAACATATACCGCCTGTTCTCAGCA
GACCGGAAGCGAGTCGAGACAGCTTTAGAGGCTTGTAGTCTTCCATCTTCAAGGAATGAT
TCGATACCTCAAGAAGATTTCACTCCTGAAGTGTACAGAGTTTTCCTGAACAACCTTTGT
CCTCGACCTGAAATTGATAACATCTTTTCCGAATTTGGTGCCAAAAGCAAACCATACCTT
ACAGTTGATCAGATGATGGATTTTATCAACCTCAAGCAGCGAGATCCCCGGCTAAATGAA
ATACTTTACCCACCTTTAAAGCAAGAGCAAGTCCAAGTGTTGATTGAGAAGTATGAACCT
AACAACAGCCTCGCCAAAAAAGGACAGATATCAGTGGATGGATTTATGCGCTATCTGAGT
GGAGAAGAAAATGGAGTCGTTTCACCTGAGAAACTGGATTTGAATGAAGATATGTCTCAG
CCCCTTTCTCACTATTTCATTAATTCCTCACACAACACCTACCTCACAGCTGGCCAGCTG
GCTGGAAACTCCTCCGTTGAGATGTATCGCCAAGTGCTCCTGTCTGGTTGTCGCTGTGTG
GAGCTGGACTGCTGGAAGGGACGAACTGCAGAAGAGGAGCCAGTCATCACCCATGGGTTC
ACCATGACCACAGAAATATCCTTCAAGGAAGTGATTGAAGCCATTGCTGAATGTGCATTT
AAGACTTCACCTTTTCCAATTCTGCTTTCATTTGAGAACCATGTGGACTCGCCGAAGCAG
CAAGCCAAGATGGCGGAGTACTGCAGACTCATCTTCGGCGACGCCCTCCTCATGGAGCCG
CTGGACAAGTACCCGTTGGAATCTGGAGTTCCCCTTCCAAGTCCTATGGATTTAATGTAC
AAAATTTTGGTGAAAAATAAGAAGAAATCACACAAGTCGTCAGAAGGAAGTGGCAAGAAG
AAGCTCTCAGAACAAGCTTCCAACACGTACAGCGACTCCTCCAGTGTGTTTGAGCCCTCG
TCCCCAGGAGCCGGAGAAGCTGATACAGAGAGTGACGATGATGACGATGATGATGACTGT
AAAAAGTCTTCAATGGATGAGGGGACCGCAGGGAGCGAGGCCATGGCCACAGAAGAGATG
TCTAATCTGGTGAACTATATCCAGCCAGTCAAGTTCGAGTCATTTGAAATTTCAAAAAAA
AGAAATAGAAGCTTCGAGATGTCTTCCTTTGTGGAAACCAAAGGTCTTGAGCAACTTACA
AAGTCTCCGGTGGAATTTGTAGAATATAACAAAATGCAGCTTAGCAGGATATATCCAAAG
GGAACACGCGTGGATTCATCTAACTATATGCCTCAGCTCTTCTGGAATGCAGGCTGCCAA
ATGGTTGCTCTTAATTTCCAAACAGTGGACCTGGCTATGCAGATAAACATGGGGATGTAT
GAATATAATGGGAAGAGTGGCTACAGGCTGAAGCCGGAGTTCATGAGGAGACCTGACAAG
CACTTTGATCCATTCACAGAAGGCATCGTGGACGGCATAGTGGCCAACACTTTATCTGTT
AAGATTATTTCAGGTCAGTTTCTCTCTGATAAGAAAGTCGGGACTTATGTGGAAGTGGAT
ATGTTTGGTTTGCCTGTGGACACAAGGAGGAAGGCATTTAAGACCAAAACATCACAAGGA
AACGCTGTAAATCCCATCTGGGAAGAAGAACCCATTGTATTCAAAAAGGTGGTCCTTCCT
TCGCTAGCCTGTTTGAGGATAGCAGTTTATGAAGAAGGAGGTAAATTTATTGGTCACCGA
ATCTTGCCAGTACAAGCAATTCGGCCAGGCTATCACTACATCTGTCTGAGGAATGAGAGG
AACCAGCCTCTCATGCTGCCAGCGCTCTTTGTCTACATAGAGGTGAAGGACTATGTCCCA
GACACATATGCAGATGTGATTGAAGCTTTGTCAAATCCAATCCGATATGTGAATCTGATG
GAGCAGAGAGCTAAACAACTGGCTGCTTTGACACTGGAAGATGAAGAAGAAGTGAAGAAA
GAGGCTGATCCTGGGGAAACACCATCAGAAGCTCCGAGTGAAGCCAGGCCAACTCCAGCA
GAAAACGGGGTGAATCACACAACGTCCCTGACACCCAAACCACCCTCCCAGGCTCTGCAC
AGCCAGCCAGCTCCAGGTTCTGTAAAGGCACCTGCCAAAACAGAAGATCTTATTCAGAGT
GTTTTAACAGAAGTAGAAGCGCAGACGATTGAAGAGCTAAAGCAGCAGAAGTCGTTTGTG
AAACTTCAAAAGAAGCACTACAAGGAAATGAAGGACCTGGTTAAGAGACACCACAAGAAA
ACCACCGACCTCATCAAAGAGCACACTACAAAATACAATGAAATCCAGAATGACTACTTG
AGAAGGAGAGCAGCTCTGGAAAAGACAGCCAAAAAGGACAATAAGAAAAAATCAGAACCC
AGTAGCCCTGACCACGTCTCATCAACAATTGAGCAAGACCTTGCTGCCCTGGATGCCGAG
ATGACCCAAAAGTTAGTAGATCTGAAGGACAAACAGCAGCAGCAGCTGCTTAATCTTCGA
CAAGAGCAATACTATAGCGAAAAATACCAGAAACGAGAACACATTAAACTGCTTATTCAA
AAATTGACTGATGTTGCTGAAGAATGTCAGAATAATCAGTTAAAGAAGCTCAAAGAAATC
TGTGAGAAAGAGAAGAAGGAATTAAAGAAGAAAATGGATAAAAAGAGGCAGGAGAAGATA
ACAGAAGCAAAATCCAAAGACAAAAGCCAGATGGAGGAGGAAAAGACAGAGATGATCCGG
TCATACATCCAGGAGGTGGTGCAGTACATCAAGAGGTTAGAAGAGGCGCAAAGTAAACGG
CAAGAAAAACTCGTAGAGAAACACAAAGAAATCCGCCAGCAGATCCTGGATGAAAAGCCC
AAGCTACAGGTGGAACTGGAGCAGGAATACCAAGACAAGTTCAAAAGGCTGCCCCTGGAG
ATTTTGGAATTTGTGCAGGAAGCCATGAAAGGGAAGATTAGTGAAGACAGCAATCACAGC
TCTGCCCCTCCCCTGATGACCTCAGACTCTGGAAAACTAAACCAGAAGCCTCCTTCCAGT
GAAGAATTGGAAGGAGAAAACCCAGGAAAAGAGTTTGATACCCCTCTGTGA
Protein Properties
Number of Residues 1216
Molecular Weight 138715.0
Theoretical pI 6.05
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-1
MAGAQPGVHALQLKPVCVSDSLKKGTKFVKWEDDSTVVTPIILRTDPQGFFFYWTDQNKE
TELLDLSLVKDARCGKHAKAPKDPKLRELLDVGNIGRLEHRMITVVYGPDLVNISHLNLV
AFQEEVAKEWTNEVFSLATNLLAQNMSRDAFLEKAYTKLKLQVTPEGRIPLKNIYRLFSA
DRKRVETALEACSLPSSRNDSIPQEDFTPEVYRVFLNNLCPRPEIDNIFSEFGAKSKPYL
TVDQMMDFINLKQRDPRLNEILYPPLKQEQVQVLIEKYEPNNSLAKKGQISVDGFMRYLS
GEENGVVSPEKLDLNEDMSQPLSHYFINSSHNTYLTAGQLAGNSSVEMYRQVLLSGCRCV
ELDCWKGRTAEEEPVITHGFTMTTEISFKEVIEAIAECAFKTSPFPILLSFENHVDSPKQ
QAKMAEYCRLIFGDALLMEPLDKYPLESGVPLPSPMDLMYKILVKNKKKSHKSSEGSGKK
KLSEQASNTYSDSSSVFEPSSPGAGEADTESDDDDDDDDCKKSSMDEGTAGSEAMATEEM
SNLVNYIQPVKFESFEISKKRNRSFEMSSFVETKGLEQLTKSPVEFVEYNKMQLSRIYPK
GTRVDSSNYMPQLFWNAGCQMVALNFQTVDLAMQINMGMYEYNGKSGYRLKPEFMRRPDK
HFDPFTEGIVDGIVANTLSVKIISGQFLSDKKVGTYVEVDMFGLPVDTRRKAFKTKTSQG
NAVNPIWEEEPIVFKKVVLPSLACLRIAVYEEGGKFIGHRILPVQAIRPGYHYICLRNER
NQPLMLPALFVYIEVKDYVPDTYADVIEALSNPIRYVNLMEQRAKQLAALTLEDEEEVKK
EADPGETPSEAPSEARPTPAENGVNHTTSLTPKPPSQALHSQPAPGSVKAPAKTEDLIQS
VLTEVEAQTIEELKQQKSFVKLQKKHYKEMKDLVKRHHKKTTDLIKEHTTKYNEIQNDYL
RRRAALEKTAKKDNKKKSEPSSPDHVSSTIEQDLAALDAEMTQKLVDLKDKQQQQLLNLR
QEQYYSEKYQKREHIKLLIQKLTDVAEECQNNQLKKLKEICEKEKKELKKKMDKKRQEKI
TEAKSKDKSQMEEEKTEMIRSYIQEVVQYIKRLEEAQSKRQEKLVEKHKEIRQQILDEKP
KLQVELEQEYQDKFKRLPLEILEFVQEAMKGKISEDSNHSSAPPLMTSDSGKLNQKPPSS
EELEGENPGKEFDTPL
GenBank ID Protein 163522
UniProtKB/Swiss-Prot ID P10894
UniProtKB/Swiss-Prot Entry Name PLCB1_BOVIN
PDB IDs Not Available
GenBank Gene ID J03137
GeneCard ID PLCB1
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available