You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00073
Secondary Accession Numbers None
Name 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase delta-4
Synonyms Not Available
Gene Name PLCD4
Protein Type Enzyme
Biological Properties
General Function Involved in calcium ion binding
Specific Function Hydrolyzes the phosphatidylinositol 4,5-bisphosphate (PIP2) to generate 2 second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3). DAG mediates the activation of protein kinase C (PKC), while IP3 releases Ca(2+) from intracellular stores. Required for acrosome reaction in sperm during fertilization, probably by acting as an important enzyme for intracellular Ca(2+) mobilization in the zona pellucida-induced acrosome reaction. May play a role in cell growth. Modulates the liver regeneration in cooperation with nuclear PKC. Overexpression up-regulates the Erk signaling pathway and proliferation (By similarity).
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 2
Locus Not Available
SNPs PLCD4
Gene Sequence
>2376 bp
ATGGCGTATCTGCTGCAAGGCCGGCTGCCCATCAATCAAGATCTGCTGCTGATGCAGAAA
GGCACAATGATGCGCAAGGTGAGGTCCAAAAGCTGGAAGAAGCTAAGATTCTTCAGACTT
CAGGACGATGGCATGACAGTCTGGCATGCCCGGCAGGCTGGAGGCAGGGCCAAGCCCAGC
TTCTCAATCTCCGACGTGGACACAGTACGTGAGGACCACGAGTCTGAGTTGCTGCGCAAC
CTGGCAGAGGAGTTCCCCCTGGAGCAGGGCTTCACCATCGTCTTCCATGGCCGCCGCTCC
AACCTGGACCTGGTGGCCAACAGTGTCCAGGAAGCCCAGACCTGGATGCAGGGGCTCCAG
CTGTTGGTGGGCTTTGTCACCAACATGGACCAACAGGAGAGGCTGGATCAATGGCTGAGT
GATTGGTTCCAGCGCGGAGACAAAAACCAGGATGGTCGGATGAGTTTCGGAGAGGTCCAA
CGGTTATTGCACCTGATGAATGTGGAAATGGACCAGGAATATGCCTTTCAGCTTTTCCAG
ACAGCAGACACATCCCAGTCTGGGACTCTGGAGGGAGAAGAATTTGTAGAGTTCTATAAG
TCATTGACTCAGCGTCCAGAAGTGCAGGAACTGTTTGAAAAGTTTTCATCTGATGGGCAG
AAACTGACCCTGTTGGAATTTGTGGATTTCCTCCAAGAGGAACAGAAGGAAGGAGAACGG
GCTTCTGACCTTGCTCTGGAACTCATCGACCGCTATGAGCCTTCAGAAAGTGGAAAACTG
CGGCATGTGCTGAGCATGGATGGCTTCCTCGGCTACCTCTGCTCGAAGGACGGAGACATC
TTCAATCCAACCTGCCACCCCCTCTACCAGGACATGACTCAACCCCTGAACCACTACTAC
ATCAACTCCTCCCACAACACCTACCTGGTGGGGGACCAGCTTTGTGGCCAGAGCAGCGTG
GAGGGATACATACGGGCCCTGAAGCGGGGGTGCCGCTGTGTGGAGGTGGATATATGGGAT
GGACCAAGCGGGGAACCTATTGTTTACCACGGACACACCCTGACCTCCCGCATCCCATTC
AAAGATGTTGTGGCCGCTATAGGACAGTATGCCTTCCAGACGTCAGACTATCCAGTCATC
TTGTCGCTGGAGAACCACTGCAGCTGGGAGCAGCAGGAGATCATCGTGCGCCATCTGACG
GAGATCCTGGGGGATCAGCTACTGACGACAGCCTTGGATGGGCAGCCTCCCACTCAGCTG
CCCTCCCCCGAGGACCTTCGGGGGAAGATCCTTGTGAAGGGGAAGAAGCTAATGCTTGAG
GAAGAGGAGGAAGAACCAGAGGCTGAATTGGAAGCAGAGCAGGAGGCTAGGCTGGACTTG
GAGGCCCAGCTGGAGTCTGAGCCCCAGGACCTGAGCCCTCGCAGTGAGGACAAAAAGAAG
GTTGTGATGTGCCCGCTGTTGTGTCGGCCTTTGTGTTGTCAGATTATGGCCCAGGCTCCT
ATTTCCAAGCCTGGGCTTCTTCTCTTTCCCAAGCAGAAACCCAAGGCCATCTTGTGTCCA
GCCCTCTCTGCCCTGGTTGTCTACTTGAAGGCTGTCACATTCTATAGCTTCACTCACTCG
AGGGAGCACTACCACTTCTATGAAACATCATCTTTCTCTGAAACCAAGGCCAAGAGCCTC
ATCAAGGAGGCTGGTGACGAGTTTGTGCAGCACAATGCCTGGCAGTTAAGCAGAGTGTAT
CCCAGTGGCCTGAGGACGGATTCATCCAACTACAACCCCCAGGAATTCTGGAATGCAGGC
TGCCAGATGGTGGCTATGAACATGCAGACAGCCGGGCTGGAGATGGACCTGTGTGATGGG
CTCTTCCGCCAGAACGCTGGCTGTGGCTATGTGCTGAAGCCAGACTTCCTGCGCGATGCC
CAGAGTTCCTTCCACCCTGAGAGGCCCATCAGCCCTTTCAAAGCCCAGACCCTCATCATC
CAGGTAATCAGTGGTCAGCAACTCCCCAAAGTGGACAACACCAAAGAACAGTCCATTGTG
GACCCCTTGGTGAGAGTGGAGATCTTTGGCGTCCGCCCAGACACAACCCGGCAAGAGACC
AGCTACGTGGAGAACAATGGTTTTAATCCATACTGGGGGCAGACACTGTGCTTCCGGATC
CTGGTACCTGAACTGGCCCTGCTGCGTTTTGTGGTCAAAGACTATGACTGGAAATCCCGA
AACGACTTCATTGGTCAGTACACCCTGCCGTGGAGCTGCATGCAGCAAGGTTACCGCCAC
ATACACCTGCTCTCCAAGGATGGCCTCAGCCTTCACCCAGCTTCCATCTTTGTGCACATC
TGCACACAGGAAGTGTCAGAGGAGGCTGAATCTTAA
Protein Properties
Number of Residues 791
Molecular Weight 90581.0
Theoretical pI 4.89
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase delta-4
MAYLLQGRLPINQDLLLMQKGTMMRKVRSKSWKKLRFFRLQDDGMTVWHARQAGGRAKPS
FSISDVDTVREDHESELLRNLAEEFPLEQGFTIVFHGRRSNLDLVANSVQEAQTWMQGLQ
LLVGFVTNMDQQERLDQWLSDWFQRGDKNQDGRMSFGEVQRLLHLMNVEMDQEYAFQLFQ
TADTSQSGTLEGEEFVEFYKSLTQRPEVQELFEKFSSDGQKLTLLEFVDFLQEEQKEGER
ASDLALELIDRYEPSESGKLRHVLSMDGFLGYLCSKDGDIFNPTCHPLYQDMTQPLNHYY
INSSHNTYLVGDQLCGQSSVEGYIRALKRGCRCVEVDIWDGPSGEPIVYHGHTLTSRIPF
KDVVAAIGQYAFQTSDYPVILSLENHCSWEQQEIIVRHLTEILGDQLLTTALDGQPPTQL
PSPEDLRGKILVKGKKLMLEEEEEEPEAELEAEQEARLDLEAQLESEPQDLSPRSEDKKK
VVMCPLLCRPLCCQIMAQAPISKPGLLLFPKQKPKAILCPALSALVVYLKAVTFYSFTHS
REHYHFYETSSFSETKAKSLIKEAGDEFVQHNAWQLSRVYPSGLRTDSSNYNPQEFWNAG
CQMVAMNMQTAGLEMDLCDGLFRQNAGCGYVLKPDFLRDAQSSFHPERPISPFKAQTLII
QVISGQQLPKVDNTKEQSIVDPLVRVEIFGVRPDTTRQETSYVENNGFNPYWGQTLCFRI
LVPELALLRFVVKDYDWKSRNDFIGQYTLPWSCMQQGYRHIHLLSKDGLSLHPASIFVHI
CTQEVSEEAES
GenBank ID Protein 86438248
UniProtKB/Swiss-Prot ID P21671
UniProtKB/Swiss-Prot Entry Name PLCD4_BOVIN
PDB IDs Not Available
GenBank Gene ID BC112449
GeneCard ID PLCD4
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available