You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00074
Secondary Accession Numbers None
Name 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase zeta-1
Synonyms Not Available
Gene Name PLCZ1
Protein Type Enzyme
Biological Properties
General Function Involved in calcium ion binding
Specific Function The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes. In vitro, hydrolyzes PtdIns(4,5)P2 in a Ca(2+)-dependent manner. Triggers intracellular Ca(2+) oscillations in oocytes solely during M phase and is involved in inducing oocyte activation and initiating embryonic development up to the blastocyst stage. Is therefore a strong candidate for the egg-activating soluble sperm factor that is transferred from the sperm into the egg cytoplasm following gamete membrane fusion. May exert an inhibitory effect on phospholipase-C-coupled processes that depend on calcium ions and protein kinase C, including CFTR trafficking and function.
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 5
Locus Not Available
SNPs PLCZ1
Gene Sequence Not Available
Protein Properties
Number of Residues 634
Molecular Weight 73732.0
Theoretical pI 7.01
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase zeta-1
MENKWFLLMVRDDFKGGKITLEKALKLLEKLDIQCNTIHVKYIFKDNDRLKQGRITIEEF
RTIYRIITYREEIIEIFNTYSENRKILLEKNLVEFLMREQYTLDFNKSIASEIIQKYEPI
EEVKQAHQMSFEGFRRYMDSSECLLFDNKCDHVYQDMTHPLTDYFISSSHNTYLISDQLW
GPSDLWGYISALVKGCRCLEIDCWDGSQNEPVVYHGYTFTSKLLFKTVIQAINKYAFLAS
EYPVVLSLENHCSPSQQEVMADSLLATFGDALLSYTLDNFSDRLPSPEALKFKILVRNKK
IGTLHETLERKGSDMHGKVEEFEEEEEIEQEEDGSGAKEPEPVGDFQDDLAKEEQLKRVV
GIPLFRKKKIKISMALSDLVIYTKVEKFKSFHHSHLYQQFNESNSIGESQARKLTKLAAR
EFILHTRRFITRVYPKALRADSSNFNPQEFWNVGCQMVALNFQTPGVPMDLQNGKFLDNG
CSGYVLKPRFLRDKKTKFNPHKVQIDSNPLTLTIRLISGIQLPPSYQNKADTLVIVEIFG
VPNDQMKQQSRVIKKNAFNPRWNETFTFVIQVPELALIRFVAENQGLIAGNEFLGQYTLP
VLCMNRGYRRVPLFSKMGESLEPASLFIYVWYIR
GenBank ID Protein 55669159
UniProtKB/Swiss-Prot ID Q1RML2
UniProtKB/Swiss-Prot Entry Name PLCZ1_BOVIN
PDB IDs Not Available
GenBank Gene ID AY646356
GeneCard ID PLCZ1
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available