You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00075
Secondary Accession Numbers None
Name 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase delta-1
Synonyms Not Available
Gene Name PLCD1
Protein Type Enzyme
Biological Properties
General Function Involved in calcium ion binding
Specific Function The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes. Essential for trophoblast and placental development.
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 22
Locus Not Available
SNPs PLCD1
Gene Sequence
>2271 bp
ATGGACTCGGGCCGGGACTTCCTGACCCTGCACGGCCTACAGGATGACAAGGACCTACAG
GCACTGCTGAAGGGCGGCCAACTCTTGAAGGTGAAGTCCAACTCATGGCGGAGAGAACGC
TTCTACAAGCTGCAGGAGGACTGCAAGACCATCTGGCAGGAGTCCCGCAAGGTCATGAGG
ACCCCGGAATCCCAGCTGTTCTCCATCGAGGACATCCAGGAGGTGCGGATGGGGCACCGC
ACAGAGGGCCTGGAGAAGTTTGCTCGGGATGTGCCTGAGAATCGCTGCTTCTCCATAGTC
TTCAAGGACCAGCGCAATACTCTAGACCTCATTGCCCCATCACCAGCCGATGCCCAGCAC
TGGGTGCAGGGCCTGGGCAAGATCATCCACCACTCGGGCTCCATGGACCAGCAGCAGAAG
CTGCGACACTGGATTCATTCCTGCTTGCGAAAAGCTGACAAAAACAAGGACAACAAGATG
AGCTTCAAAGAGCTACAAAACTTTCTGAAGGAGCTCAACATCCAGGTGGACGACAGCTAT
GCCCGAAAGATCTTCAAGGAATGTGACCACTCTCAGACAGACTCCCTGGAGGATGAGGAG
ATAGAGACCTTCTACAAGATACTGACCCAGAGGAAGGAGATCGACCGCACCTTCGAGGAG
GCCACGGGCTCCAAGGAGACCCTGTCGGTGGATCAGTTGGTGACCTTCTTGCAGCACCAG
CAGCGGGAGGAGGAGGCGGGGCCTGCACTGGCTCTCTCCCTCATTGAGCGCTACGAACCC
AGTGAGACGGCCAAGGCGCAGCGTCAGATGACCAAGGACGGCTTTCTTATGTACCTGCTC
TCGGCTGACGGCAGCGCCTTCGACCTGGCGCACCGGCGCGTCTACCAGGACATGGACCAG
CCGCTCAGCCACTACCTGGTGTCGTCCTCGCACAACACCTACCTGCTGGAAGACCAGCTC
ACGGGTCCCAGCAGCACAGAAGCCTACATCCGGGCGCTGTGCAAAGGCTGCCGCTGCCTG
GAGCTCGACTGCTGGGATGGGCCCAACCAGGAGCCGATCATCTATCATGGCTACACCTTC
ACCTCCAAGATCCTCTTCTGCGACGTGGTCAGGGCCATCCGGGACTACGCCTTCAAGGCA
TCCCCCTACCCCGTCATCCTGTCCTTGGAGAACCACTGCAGCCTGGAACAGCAGCGTGTG
ATGGCGCGACACCTGCGCACCCTCCTGGGGCCCATGCTGTTGGATCGGCCATTGGACGGG
GTCGTCACCAGCCTGCCTTCCCCTGAGCAACTGAGGGGGAAGATCTTGCTGAAGGGGAAG
AAGCTTGGGGGGCTCTTCCCGCCTGGAGGAGAAGGTGGCCCAGAGGCCACTGTGGTGTCA
GACGAGGATGAGGCTGCTGAGATGGAGGACGAGGCGGTGAGGAGCCAAGTGCAGCACAAG
TCCAAGGAGGACAAGCTCAGGCTAGCGAAGGAACTCTCCGACATGGTCATTTACTGCAAG
AGTGTCCACTTTCGGGGCTTCCCCAGCTCTGGCACCTCTGGACAGGCTTTCTATGAGATG
TCATCCTTCTCTGAGAACCGCGCCCTCCGACTGCTCCAAGAATCAGGAAACAGCTTTGTC
CGCCACAACGTGAATCACCTGAGCAGGATCTACCCCGCTGGGTGGAGAACGGACTCTTCC
AACTACAGCCCCGTGGAGATGTGGAATGGGGGCTGCCAGATCGTGGCCCTGAACTTCCAG
ACTCCTGGGTCAGAGATGGATGTGTACCAGGGCCGCTTCCTGGACAATGGGGCCTGTGGG
TACGTGCTGAAGCCTGCCTTCCTGCGAGACCCCAACTCTACCTTCAACTCCCGTGCCCTG
GCCCACGGGCCCTGGTGGACTCCGAAACGACTCAATGTCAGGGTCATCTCAGGGCAGCAG
CTGCCAAAAGTCAACAAGAATAAGAATTCAATCGTGGACCCCAAGGTGACAGTGGAGATC
CATGGCGTGAGCCGGGACGTGGCCAGCCGCCAGACCGCTGTGGTCACCAATAACGGTTTC
AATCCGTGGTGGGACACAGAGTTGGAGTTTGAGGTGGCTGTGCCTGAGCTTGCCCTTGTG
CGCTTTGTGGTGGAGGACTACGATGCCTCCTCCAAGAACGACTTCATTGGCCAGAGCACC
ATCCCCTTGAAAAGCCTCAAGCAGGGATACCGACACATCCACCTCCTCTCCAAGAACGGG
GACCAGCACCCGTCTGCCACCCTCTTTGTGAAGGTGGCCCTCCAGGACTAG
Protein Properties
Number of Residues 756
Molecular Weight 86073.0
Theoretical pI 6.72
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase delta-1
MDSGRDFLTLHGLQDDKDLQALLKGGQLLKVKSNSWRRERFYKLQEDCKTIWQESRKVMR
TPESQLFSIEDIQEVRMGHRTEGLEKFARDVPENRCFSIVFKDQRNTLDLIAPSPADAQH
WVQGLGKIIHHSGSMDQQQKLRHWIHSCLRKADKNKDNKMSFKELQNFLKELNIQVDDSY
ARKIFKECDHSQTDSLEDEEIETFYKILTQRKEIDRTFEEATGSKETLSVDQLVTFLQHQ
QREEEAGPALALSLIERYEPSETAKAQRQMTKDGFLMYLLSADGSAFDLAHRRVYQDMDQ
PLSHYLVSSSHNTYLLEDQLTGPSSTEAYIRALCKGCRCLELDCWDGPNQEPIIYHGYTF
TSKILFCDVVRAIRDYAFKASPYPVILSLENHCSLEQQRVMARHLRTLLGPMLLDRPLDG
VVTSLPSPEQLRGKILLKGKKLGGLFPPGGEGGPEATVVSDEDEAAEMEDEAVRSQVQHK
SKEDKLRLAKELSDMVIYCKSVHFRGFPSSGTSGQAFYEMSSFSENRALRLLQESGNSFV
RHNVNHLSRIYPAGWRTDSSNYSPVEMWNGGCQIVALNFQTPGSEMDVYQGRFLDNGACG
YVLKPAFLRDPNSTFNSRALAHGPWWTPKRLNVRVISGQQLPKVNKNKNSIVDPKVTVEI
HGVSRDVASRQTAVVTNNGFNPWWDTELEFEVAVPELALVRFVVEDYDASSKNDFIGQST
IPLKSLKQGYRHIHLLSKNGDQHPSATLFVKVALQD
GenBank ID Protein 124828965
UniProtKB/Swiss-Prot ID P10895
UniProtKB/Swiss-Prot Entry Name PLCD1_BOVIN
PDB IDs Not Available
GenBank Gene ID BC133304
GeneCard ID PLCD1
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available