You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00076
Secondary Accession Numbers None
Name 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-1
Synonyms Not Available
Gene Name PLCG1
Protein Type Enzyme
Biological Properties
General Function Involved in calcium ion binding
Specific Function Mediates the production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3). Plays an important role in the regulation of intracellular signaling cascades. Becomes activated in response to ligand-mediated activation of receptor-type tyrosine kinases, such as PDGFRA, PDGFRB, FGFR1, FGFR2, FGFR3 and FGFR4. Plays a role in actin reorganization and cell migration (By similarity).
Pathways
  • BCR Signaling Pathway
  • CXCR4 Signaling Pathway
  • EGF Signalling Pathway
  • EPO Signaling Pathway
  • Fc Epsilon Receptor I Signaling in Mast Cells
  • Growth Hormone Signaling Pathway
  • Ion Channel and Phorbal Esters Signaling Pathway
  • Phospholipase C Signaling Pathway
  • Phospholipase C Signaling Pathway
  • T Cell Receptor Signaling Pathway
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 13
Locus Not Available
SNPs PLCG1
Gene Sequence
>3876 bp
ATGGCGGGCGCCGCGTCCCCCTGCGCCAACGGCTGCGGGCCCAGTGCGCCCTCGGACGCC
GAGGTGGTGCACCTCTGCCGCAGCCTCGAGGTGGGCACCGTCATGACTTTGTTCTACTCC
AAGAAGTCGCAGCGGCCCGAGCGGAAGACCTTCCAGGTCAAGCTGGAGACGCGGCAGATC
ACGTGGAGCCGAGGCGCCGACAAGATAGAGGGGGCCATTGACATTCGTGAAATCAAGGAG
ATCCGCCCAGGGAAGACCTCACGGGACTTCGATCGCTACCAAGAGGATCCTGCTTTTCGA
CCGGACCAGTCCCACTGCTTCGTCATCCTGTATGGAATGGAATTCCGCCTGAAGACCCTG
AGCCTCCAAGCCACGTCTGAGGACGAAGTGAACATGTGGATCAGGGGCCTGACTTGGCTG
ATGGAGGACACGTTGCAGGCAGCCACACCCCTGCAGATTGAGAGGTGGCTGCGGAAGCAG
TTCTACTCAGTGGACCGGAACCGTGAGGACCGGATATCGGCCAAGGACCTGAAGAACATG
CTGTCCCAGGTCAACTACCGGGTCCCCAACATGCGCTTCCTCCGGGAGCGGCTGACGGAC
CTGGAGCAGCGCACCAGTGACATCACCTACGGGCAGTTTGCACAGCTGTACCGCAGCCTC
ATGTACAGCGCCCAGAAGACGATGGACCTTCCTTTCCTGGAAGCCAGCGCCCTGAGGGCG
GGGGAGCGGCCGGAGCTGTGCCGGGTGTCCCTTCCTGAGTTCCAGCAGTTCCTCCTCGAG
TACCAAGGGGAGCTGTGGGCGGTGGACCGGCTCCAGGTGCAGGAGTTCATGCTCAGCTTC
CTCCGAGACCCCTTGCGAGAGATTGAGGAGCCTTACTTCTTCCTGGACGAGTTCGTCACC
TTCCTGTTCTCCAAGGAGAACAGCATATGGAACTCGCAGCTAGACGAGGTGTGCCCCGAC
ACCATGAACAACCCCCTGTCCCACTACTGGATCTCCTCCTCGCACAACACGTACCTGACC
GGGGACCAGTTCTCCAGCGAGTCCTCCCTGGAAGCCTACGCTCGCTGCCTGCGGATGGGC
TGCCGTTGCATTGAGTTGGACTGCTGGGACGGCCCGGATGGGATGCCGGTCATTTACCAT
GGACACACTCTGACCACCAAGATCAAGTTCTCAGACGTCCTGCACACCATCAAGGAGCAC
GCCTTTGTGGCCTCAGAGTACCCGGTCATCCTGTCCATCGAGGACCACTGCAGCATTGCC
CAGCAGAGGAACATGGCCCAGTATTTCAAAAAGGTGCTTGGGGACACACTCCTCACCAAG
CCCGTGGATATTGCAGCCGACGGGCTCCCCTCCCCCAACCAGCTCAAGAGGAAGATCCTT
ATCAAGCACAAGAAGTTGGCTGAGGGCAGTGCCTACGAGGAGGTGCCAACATCGGTGATG
TACTCTGAGAACGACATCAGCAACTCCATCAAGAATGGCATCCTCTACCTGGAAGACCCT
GTGAACCATGAGTGGTACCCCCACTACTTCGTCCTGACCAGCAGCAAGATCTACTACTCG
GAGGAGACCAGCAGCGACCAGGGCAACGAGGATGAGGAGGAGCCCAAGGAGGCCAGTGGC
AGCACAGAGCTGCACTCCAACGAGAAGTGGTTCCACGGGAAGCTTGGGGCGGGCCGGGAT
GGGCGGCACATCGCCGAGCGCCTGCTCACGGAGTACTGCATTGAGACCGGGGCCCCCGAC
GGCTCCTTCCTTGTGCGCGAGAGCGAGACCTTTGTGGGCGACTACACTCTGTCCTTCTGG
CGGAATGGCAAAGTGCAGCACTGCCGGATCCACTCCCGGCAGGACGCAGGCACCCCCAAG
TTCTTCCTGACGGACAACCTCGTCTTCGACTCCCTCTATGACCTCATCACGCACTACCAG
CAGGTGCCCCTGCGCTGCAACGAATTTGAGATGCGCCTCTCAGAGCCGGTCCCGCAGACC
AACGCGCACGAGAGCAAAGAGTGGTACCACGCCAGCCTGACCAGAGCGCAGGCCGAGCAC
ATGCTGATGCGTGTACCCAGGGACGGGGCCTTCCTGGTGCGGAAACGGAACGAGCCCAAC
TCCTACGCCATCTCCTTCCGGGCTGAGGGCAAGATCAAGCACTGCCGCGTCCAGCAGGAG
GGCCAGACCGTGATGCTGGGCAACTCAGAGTTTGACAGCCTTGTCGACCTCATCAGCTAC
TACGAGAAGCACCCACTGTACCGCAAGATGAAGCTGCGCTACCCCATCAACGAGGAGGCT
CTGGAGAAGATCGGCACAGCTGAGCCTGACTACGGCGCGCTGTACGAGGGCCGCAACCCT
GGCTTCTATGTGGAGGCGAACCCCATGCCCACGTTCAAGTGCGCCGTCAAAGCTCTCTTC
GACTACAAAGCGCAGCGGGAGGACGAGCTGACATTCACCAAGAGTGCCATCATCCAGAAC
GTGGAGAAGCAGGAGGGAGGCTGGTGGCGGGGTGACTACGGCGGGAAGAAGCAGCTGTGG
TTCCCTTCAAACTATGTGGAGGAAATGGTCAGCCCGGCGGCCCTGGAGCCCGAGAGGGAG
CACTTGGACGAGAACAGCCCACTCGGGGACTTGCTCCGGGGGGTCCTGGATGTGCCAGCT
TGTCAGATAGCCGTCCGTCCCGAGGGCAAGAACAACCGGCTGTTCGTCTTCTCCATCAGC
ATGGCCTCGGTGGCACACTGGTCCCTGGATGTGGCTGCCGACTCGCAGGAAGAGCTGCAG
GACTGGGTGAAGAAGATCCGGGAGGTGGCGCAGACAGCGGATGCCAGGCTCACCGAGGGC
AAGATGATGGAGCGGAGGAAGAAGATCGCCCTAGAGCTCTCAGAGCTCGTCGTCTACTGC
CGGCCTGTCCCTTTCGACGAAGAGAAGATTGGCACCGAACGGGCCTGCTACCGCGACATG
TCGTCCTTCCCGGAGACCAAGGCCGAGAAGTACGTGAACAAGGCCAAAGGCAAGAAGTTC
CTCCAGTACAACCGCCTGCAGCTCTCCCGCATCTACCCTAAGGGCCAGCGGCTGGACTCC
TCCAATTACGACCCCCTGCCCATGTGGATCTGCGGCAGCCAGCTTGTGGCCCTCAACTTC
CAGACCCCAGACAAACCCATGCAGATGAACCAGGCCCTGTTCCTGGCCGGCGGGCACTGT
GGCTATGTGCTGCAGCCCAGCGTCATGCGCGATGAGGCCTTCGATCCCTTTGACAAGAGC
AGCCTCCGCGGGCTGGAGCCGTGCGCCATCTGCATCGAGGTGCTGGGGGCCCGGCACCTG
CCGAAGAACGGCCGAGGCATCGTGTGTCCTTTTGTGGAGATCGAGGTGGCCGGAGCCGAG
TATGACAGCATCAAGCAGAAGACAGAGTTTGTGGTGGACAATGGACTGAACCCCGTGTGG
CCAGCCAAGCCCTTCCACTTCCAGATTAGTAACCCCGAGTTCGCCTTCCTGCGCTTCGTG
GTCTATGAGGAGGACATGTTTAGTGACCAGAACTTCCTAGCTCAGGCTACCTTCCCAGTG
AAGGGTCTGAAGACAGGCTACAGAGCGGTGCCTCTGAAGAACAACTACAGTGAGGGCCTG
GAGCTGGCCTCCCTGCTCGTCAAGATTGACGTGTTCCCTGCCAAGCAGGAGAACGGCGAC
CTCAGCCCCTTCGGGGGTGCGTCCCTGCGGGAGCGGAGCTGTGACGCCTCGGGCCCGCTG
TTCCACGGCCGGGCCCGGGAGGGCTCCTTTGAAGCTCGCTACCAGCAGCCCTTTGAGGAC
TTCCGCATCTCCCAGGAGCATCTCGCAGACCATTTTGACGGTCGGGATCGCAGGACCCCA
CGCAGGACTCGGGTCAACGGAGACAACCGCCTGTAG
Protein Properties
Number of Residues 1291
Molecular Weight 148313.0
Theoretical pI 5.85
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-1
MAGAASPCANGCGPSAPSDAEVVHLCRSLEVGTVMTLFYSKKSQRPERKTFQVKLETRQI
TWSRGADKIEGAIDIREIKEIRPGKTSRDFDRYQEDPAFRPDQSHCFVILYGMEFRLKTL
SLQATSEDEVNMWIRGLTWLMEDTLQAATPLQIERWLRKQFYSVDRNREDRISAKDLKNM
LSQVNYRVPNMRFLRERLTDLEQRTSDITYGQFAQLYRSLMYSAQKTMDLPFLEASALRA
GERPELCRVSLPEFQQFLLEYQGELWAVDRLQVQEFMLSFLRDPLREIEEPYFFLDEFVT
FLFSKENSIWNSQLDEVCPDTMNNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMG
CRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVLHTIKEHAFVASEYPVILSIEDHCSIA
QQRNMAQYFKKVLGDTLLTKPVDIAADGLPSPNQLKRKILIKHKKLAEGSAYEEVPTSVM
YSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEASG
STELHSNEKWFHGKLGAGRDGRHIAERLLTEYCIETGAPDGSFLVRESETFVGDYTLSFW
RNGKVQHCRIHSRQDAGTPKFFLTDNLVFDSLYDLITHYQQVPLRCNEFEMRLSEPVPQT
NAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKIKHCRVQQE
GQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPDYGALYEGRNP
GFYVEANPMPTFKCAVKALFDYKAQREDELTFTKSAIIQNVEKQEGGWWRGDYGGKKQLW
FPSNYVEEMVSPAALEPEREHLDENSPLGDLLRGVLDVPACQIAVRPEGKNNRLFVFSIS
MASVAHWSLDVAADSQEELQDWVKKIREVAQTADARLTEGKMMERRKKIALELSELVVYC
RPVPFDEEKIGTERACYRDMSSFPETKAEKYVNKAKGKKFLQYNRLQLSRIYPKGQRLDS
SNYDPLPMWICGSQLVALNFQTPDKPMQMNQALFLAGGHCGYVLQPSVMRDEAFDPFDKS
SLRGLEPCAICIEVLGARHLPKNGRGIVCPFVEIEVAGAEYDSIKQKTEFVVDNGLNPVW
PAKPFHFQISNPEFAFLRFVVYEEDMFSDQNFLAQATFPVKGLKTGYRAVPLKNNYSEGL
ELASLLVKIDVFPAKQENGDLSPFGGASLRERSCDASGPLFHGRAREGSFEARYQQPFED
FRISQEHLADHFDGRDRRTPRRTRVNGDNRL
GenBank ID Protein 639
UniProtKB/Swiss-Prot ID P08487
UniProtKB/Swiss-Prot Entry Name PLCG1_BOVIN
PDB IDs Not Available
GenBank Gene ID Y00301
GeneCard ID PLCG1
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available