You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00077
Secondary Accession Numbers None
Name 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-4
Synonyms Not Available
Gene Name PLCB4
Protein Type Enzyme
Biological Properties
General Function Replication, recombination and repair
Specific Function The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes. This form has a role in retina signal transduction.
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 13
Locus Not Available
SNPs PLCB4
Gene Sequence Not Available
Protein Properties
Number of Residues 1023
Molecular Weight 117110.0
Theoretical pI 6.73
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-4
PVRSITRTFASGKTEKVIFQALKELGLPSGKNDEIEPAAFTYEKFYELTQKICPRTDIED
LFKKINGDKTDYLTVDQLVSFLNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDEDLKKQ
GLISSDGFCRYLMSDENAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVE
MYRQVLLAGCRCVELDCWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPV
ILSFENHCSKYQQYKMSKYCEDLFGDLLLKQALESHPLEPGRPLPSPNDLKRKILIKKQT
TETEVEKKQLEALKSMMEAGESAAPVNMLEDDNEEEIESAEQEEEAHPEYKYGNELSADD
LGHKEAIANSVKKASDDLEHENSKKGLVTVEDEQAWMASYKYVGATTNIHPYLSTMINYA
QPVKFQGFHVAEERNIHYNMSSFNESVGLGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSS
NYMPQIFWNSGCQMVSLNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSE
TPVDGVIAATCSVQVISGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVY
NEESFVFRKVILPDLAVLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLP
TIFCNIVLKTYVPDGFGDIVDALSDPKKFLSITEKRADQMRAMGIETSDIADVPSDTSKN
DKKGKANTAKANVTPQSSSELRPTTTAALGAGLEAKKGIELIPQVRIEDLKQMKAYLKHL
KKQQKELSSLKKKHAKEHSTMQKLHCTQVDKIVAQYDKEKLTHEKILEKAMKKKGGSNCL
EMKKETEIKIQTLTSDHKSKVKEIVAQHTKEWSDMINTHSAEEQEIRDLLLSQQCELLRK
LLISAHEQQTQQLKLSHDRESKEMRAHQAKISMENSKAISQDKSIKNKAERERRVRELNS
SNTKKFLEERKRLAMKQSKEMDQLKKVQLEHLEFVEKQNEQAKEMQQMVKLEAEMDRRPA
TVV
GenBank ID Protein 304241
UniProtKB/Swiss-Prot ID Q07722
UniProtKB/Swiss-Prot Entry Name PLCB4_BOVIN
PDB IDs Not Available
GenBank Gene ID L13936
GeneCard ID PLCB4
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available