You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00193
Secondary Accession Numbers None
Name 2',3'-cyclic-nucleotide 3'-phosphodiesterase
Synonyms Not Available
Gene Name CNP
Protein Type Enzyme
Biological Properties
General Function Involved in 2',3'-cyclic-nucleotide 3'-phosphodiesteras
Specific Function May participate in RNA metabolism in the myelinating cell, CNP is the third most abundant protein in central nervous system myelin.
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 19
Locus Not Available
SNPs CNP
Gene Sequence
>1203 bp
ATGTCATCCTCAGGGGCCAAGGACAAGCCGGAGCTGCAGTTTCCCTTCCTGCAGGATGAG
GAGACGGTGGCCACGCTGCAGGAGTGCAAGACGCTCTTCATCCTGCGAGGCCTGCCTGGG
AGCGGCAAGTCCACGCTGGCCCGGTTCATCGTGGACAAGTACCGGGATGGCACCAAGATG
GTGTCTGCCGACAGCTACAAGATCACCCCTGGCGCCCGGGGATCCTTCTCTGAGGAGTAC
AAGCAGCTGGACGAGGACCTGGCTGCCTGTTGCCGCCGGGATTTCCGGGTCCTGGTGCTG
GATGATACCAACCATGAGCGGGAGCGGCTGGAGCAGCTCTTTGAGCTGGCCGACCAGTAC
CAGTACCAGGTGGTGCTGGTGGAGCCCAAGACGGCCTGGCGGCTGGACTGTGCCCAGCTC
AAGGAGAAGAACCAGTGGCAGCTGTCAGCAGATGATCTGAAGAAGCTGAAGCCTGGGCTG
GAGAAGGACTTCCTGCCGCTTTACTTCGGCTGGTTCCTGACCAAGAAGAGTTCCGCGGCC
CTCTGGAAAACTGGCCAGACCTTCCTGGAGGAGCTGGGCAATCACAAGGCCTTCAAGAAG
GAGCTGCGACACTTTGTCTCTGGGGATGAGCCCAGGGAGAAGATTGAACTGGTCACCTAC
TTCGGGAAGAGACCGCCGGGCGTGCTGCATTGCACAACCAAGTTCTGTGACTACGGGAAG
GCCGCTGGGGCAGAGGAGTATGCCCAGCAAGATGTAGTGAAGAAATCCTACTGCAAGGCC
TTCACGCTGACCATCTCGGCCCTCTTCGTGACACCCAAGACGACGGGAGCCAGAGTAGAG
CTGAGCGAGCAGCAGCTGGCCTTGTGGCCAAACGACGTGGACAAGCTGTCTCCCTCTGAC
AACCTGCCACGGGGCAGCCGCGCACACATCACCTTGGGCTGCGCGGGTGACGTAGAGGCC
GTGCAGACAGGCATCGACCTGCTAGAGATTGTGCGGCAGGAGAAGGGGGGCAGCCGCGGC
GAGGAGGTGGGTGAGCTCAGCCGGGGCAAGCTCTACTCCCTGGGCAGCGGGCGCTGGATG
CTGAGCCTGGCCAAGAAGATGGAGGTCAGGGCTATCTTTACAGGATACTACGGGAAGGGC
AAGGCCGTGCCCATACGCAGCGGCCGCAAGGGTGGCTCCTTTCAGTCCTGTACCATCATC
TGA
Protein Properties
Number of Residues 400
Molecular Weight 44875.0
Theoretical pI 8.58
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>2',3'-cyclic-nucleotide 3'-phosphodiesterase
MSSSGAKDKPELQFPFLQDEETVATLQECKTLFILRGLPGSGKSTLARFIVDKYRDGTKM
VSADSYKITPGARGSFSEEYKQLDEDLAACCRRDFRVLVLDDTNHERERLEQLFELADQY
QYQVVLVEPKTAWRLDCAQLKEKNQWQLSADDLKKLKPGLEKDFLPLYFGWFLTKKSSAA
LWKTGQTFLEELGNHKAFKKELRHFVSGDEPREKIELVTYFGKRPPGVLHCTTKFCDYGK
AAGAEEYAQQDVVKKSYCKAFTLTISALFVTPKTTGARVELSEQQLALWPNDVDKLSPSD
NLPRGSRAHITLGCAGDVEAVQTGIDLLEIVRQEKGGSRGEEVGELSRGKLYSLGSGRWM
LSLAKKMEVRAIFTGYYGKGKAVPIRSGRKGGSFQSCTII
GenBank ID Protein 262
UniProtKB/Swiss-Prot ID P06623
UniProtKB/Swiss-Prot Entry Name CN37_BOVIN
PDB IDs Not Available
GenBank Gene ID Y00405
GeneCard ID CNP
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available