You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00225
Secondary Accession Numbers None
Name 1-aminocyclopropane-1-carboxylate synthase
Synonyms Not Available
Gene Name ACS
Protein Type Enzyme
Biological Properties
General Function Amino acid transport and metabolism
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 15
Locus Not Available
SNPs ACS
Gene Sequence
>1677 bp
ATGTTCACCCTCCCTCAGAAGGAATTCAGGATGACTACCGCCTGTCCAGGTTCAGACTCC
ATACAGGACCTGCCCAGTAACAAGGGAGATGGTCTGGAAAGAGAATGCTCCAGAAAACCC
GACCAGAAGCTGCTGAAGTTCTATGGAGTGGGTGACCCCGCTGCCGAGCTCTCCTCCAGC
AGCCCCTACCTGTCCTCTAGAGGCAGCGTCATTAAATGGTTCTGGGATTCAGCGGAGGAG
GGCTACAGGACCTACCACATGGATGAATATGATGAGGACAAGAACCCCAGTGGCATCATT
AACTTGGGCACCAGTGAGAACAAACTCTGCTTTGACCTGCTGTCCAGACGGGTAAGTCCC
ACTGCACCTCTGAGCGGCATCCCCAGCTCCAAGGGGCTGTCTTCTCTGGGATTCCCTGGA
ATGCTCCCCCCAGAGAGCCGGCTGCTTGCCTCAGTTGCCCCAGTCTTGGAGTCAGGAGAC
CCACCTCTGCCTTGGGGACCACGTTCTCTGCCATCTGGGCTGAGTCAGAGTGACATGCTG
CAGGTGGAGCCGGCCCTGTTGCAGTACCCCGACTGGAGGGGACATCTGTTCCTCCGGGAG
GAAGTGGCCAGGTTCCTATCTTTCTACTGCAGAAGCCCCGCACCCCTTAAACCGGAGAAT
GTGGTTGTTCTGAACGGCTGTGCCTCTCTCTTCTCTGCTCTGGCCACGGTGCTGTGTGAG
GCAGGAGAGGCTTTCCTGATCCCTGCCCCTTACTATGGAGCCATCACACAGCACGTGTAT
CTCTATGGCAACGTCCGACTGGTCTGTGTCTATCTGGACAGTGAGGTCACTGGGCTGGAA
ACACGCCCCTTCCAGCTCACAGTGGAGAAGCTGGAGATGGCCCTGCAAGGAGCTAATTCT
GAGGGTGTGAAGGTCAAAGGCCTCATCCTCATCAACCCCCAGAATCCTCTGGGTGACATC
TATTCCCCAGGGGAGCTGCAGGAGTACCTGGAGTTTGCCAAGAGGCACGAGCTGCACGTG
ATGGTGGACGAGGTCTACATGCTGTCCGTGTTTGAGGAGTCAGCTGGGTACCGCAGTGTC
CTGAGCCTGGAAAGGCTGCCTGACCCCCAGAGGACCCACGTGATGTGGGCGACCAGCAAG
GACTTCGGGATGTCTGGGCTCCGCTTCGGCACGCTGTACACGGAAAACCGGGCCGTGGCC
ACGGCGGTGGCCTCCCTGTGCCGCTATCACGGCCTCAGTGGCCTGGTCCAGTACCAGATG
GCACAGCTGCTCCGGGACCATGACTGGATCAACCAAGTGTATCTGCCAGAAAACCACGCC
CGGCTCAAGGCTGCCCACACCTATGTCTCTGAGGACCTCCGGGCCCTGGGTATCCCCTTC
GTGAGCCGTGGGGCCGGCTTCTTCATCTGGGTCGACTTGAGGAAGTACCTGCCCGAGGCC
ACCTTTGAGGAGGAGGTGCTGCTCTGGCGTCGATTTTTGGAGAACAAGGTGCTGCTGTCC
TTTGGCAAAGCCTTTGAGTGCAAAGAGCCCGGCTGGTTCCGCTTGGTCTTCTCGGACAAG
ACCCACCGGCTTCACCTGGGGATGCAGAGGGTCCGACAGGTGCTTGAGGGCCAACCCCAG
CTGGCAGACGGCGCCCCTCCCCACCAGATCCAGGAGCCACAAGGCCCCCACAGGTGA
Protein Properties
Number of Residues 558
Molecular Weight 62580.0
Theoretical pI 6.04
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>1-aminocyclopropane-1-carboxylate synthase
MFTLPQKEFRMTTACPGSDSIQDLPSNKGDGLERECSRKPDQKLLKFYGVGDPAAELSSS
SPYLSSRGSVIKWFWDSAEEGYRTYHMDEYDEDKNPSGIINLGTSENKLCFDLLSRRVSP
TAPLSGIPSSKGLSSLGFPGMLPPESRLLASVAPVLESGDPPLPWGPRSLPSGLSQSDML
QVEPALLQYPDWRGHLFLREEVARFLSFYCRSPAPLKPENVVVLNGCASLFSALATVLCE
AGEAFLIPAPYYGAITQHVYLYGNVRLVCVYLDSEVTGLETRPFQLTVEKLEMALQGANS
EGVKVKGLILINPQNPLGDIYSPGELQEYLEFAKRHELHVMVDEVYMLSVFEESAGYRSV
LSLERLPDPQRTHVMWATSKDFGMSGLRFGTLYTENRAVATAVASLCRYHGLSGLVQYQM
AQLLRDHDWINQVYLPENHARLKAAHTYVSEDLRALGIPFVSRGAGFFIWVDLRKYLPEA
TFEEEVLLWRRFLENKVLLSFGKAFECKEPGWFRLVFSDKTHRLHLGMQRVRQVLEGQPQ
LADGAPPHQIQEPQGPHR
GenBank ID Protein 110331859
UniProtKB/Swiss-Prot ID Q0V8M2
UniProtKB/Swiss-Prot Entry Name Q0V8M2_BOVIN
PDB IDs Not Available
GenBank Gene ID BT026196
GeneCard ID ACS
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available