You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00240
Secondary Accession Numbers None
Name 14-3-3 protein zeta/delta
Synonyms Not Available
Gene Name YWHAZ
Protein Type Enzyme
Biological Properties
General Function Involved in protein domain specific binding
Specific Function Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Activates the ADP-ribosyltransferase (exoS) activity of bacterial origin.
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 14
Locus Not Available
SNPs YWHAZ
Gene Sequence
>738 bp
ATGGATAAAAACGAGCTGGTACAGAAGGCCAAACTGGCCGAGCAGGCTGAGCGATATGAT
GACATGGCAGCCTGCATGAAGTCTGTAACTGAGCAAGGAGCTGAATTATCCAATGAGGAG
AGGAATCTTCTCTCAGTTGCTTATAAAAATGTTGTAGGAGCCCGTAGGTCATCTTGGAGG
GTCGTCTCCAGTATTGAGCAAAAGACGGAAGGTGCTGAGAAAAAACAGCAGATGGCTCGA
GAATACAGAGAGAAAATAGAGACCGAGCTAAGAGATATCTGCAATGATGTACTGTCTCTT
TTGGAAAAGTTCTTGATCCCCAACGCTTCACAAGCAGAGAGCAAAGTCTTCTATTTGAAA
ATGAAAGGAGACTACTACCGCTACTTGGCTGAGGTTGCAGCTGGTGATGACAAGAAAGGG
ATTGTGGACCAGTCACAGCAAGCATACCAAGAAGCTTTTGAAATCAGCAAAAAGGAAATG
CAACCAACACATCCTATCAGACTGGGTCTGGCCCTTAACTTCTCTGTGTTCTATTATGAG
ATTCTGAACTCCCCTGAGAAAGCCTGCTCTCTTGCAAAGACAGCATTTGATGAAGCCATT
GCTGAACTTGATACATTAAGTGAAGAGTCATACAAAGACAGCACGCTAATAATGCAGTTA
CTGAGAGATAACTTGACATTGTGGACATCGGATACCCAAGGAGACGAAGCTGAAGCAGGA
GAAGGAGGGGAAAATTAA
Protein Properties
Number of Residues 245
Molecular Weight 27745.0
Theoretical pI 4.43
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • 673-696
Protein Sequence
>14-3-3 protein zeta/delta
MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWR
VVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLK
MKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYE
ILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAG
EGGEN
GenBank ID Protein 163042
UniProtKB/Swiss-Prot ID P63103
UniProtKB/Swiss-Prot Entry Name 1433Z_BOVIN
PDB IDs
GenBank Gene ID L07955
GeneCard ID YWHAZ
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available