You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00241
Secondary Accession Numbers None
Name 14-3-3 protein eta
Synonyms Not Available
Gene Name YWHAH
Protein Type Enzyme
Biological Properties
General Function Involved in protein domain specific binding
Specific Function Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Negatively regulates the kinase activity of PDPK1 (By similarity).
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 17
Locus Not Available
SNPs YWHAH
Gene Sequence
>741 bp
AGCGAGGCCGGGCTCAGCGACATGGGGGACCGCGAGCAGCTGCTGCAGCGGGCGCGGCTG
GCCGAGCAGGCGGAGCGCTACGACGACATGGCCTCCGCCATGAAGGCGGTGACTGAGCTC
AATGAACCTCTCTCCAACGAAGACCGAAACCTCCTCTCCGTGGCCTACAAGAACGTGGTT
GGTGCCCGGCGGTCTTCCTGGAGGGTCATCAGCAGCATCGAGCAGAAGACCATGGCTGAT
GGGAATGAGAAGAAGCTGGAGAAGGTGAAGGCCTACCGGGAGAAGATTGAGAAGGAGCTG
GAGACGGTGTGCAACGACGTGCTGGCGCTGCTGGACAAGTTCCTCATCAAGAACTGCAAT
GACTTCCAGTACGAGAGCAAGGTCTTCTACCTGAAGATGAAGGGCGACTACTACCGCTAC
CTGGCCGAGGTGGCTTCTGGCGAGAAGAAGAACAGTGTGGTGGAGGCCTCAGAGGCGGCC
TACAAGGAAGCCTTCGAGATTAGCAAGGAGCACATGCAGCCCACACACCCCATCCGGCTG
GGCCTGGCCCTCAACTTCTCCGTGTTCTACTACGAGATCCAGAATGCGCCTGAGCAGGCC
TGCCTCCTAGCCAAACAAGCCTTCGACGACGCCATAGCCGAGCTGGACACACTAAACGAG
GATTCCTATAAGGACTCCACGCTCATCATGCAGCTGCTGCGAGACAACCTCACCCTCTGG
ACGAGCGACCAGCAGGACGAG
Protein Properties
Number of Residues 246
Molecular Weight 28212.0
Theoretical pI 4.52
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>14-3-3 protein eta
MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSW
RVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLALLDKFLIKNCNDFQYESK
VFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEHMQPTHPIRLGLALNFS
VFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDE
EAGEGN
GenBank ID Protein 162592
UniProtKB/Swiss-Prot ID P68509
UniProtKB/Swiss-Prot Entry Name 1433F_BOVIN
PDB IDs Not Available
GenBank Gene ID J03868
GeneCard ID YWHAH
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available