You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00242
Secondary Accession Numbers None
Name 14-3-3 protein gamma
Synonyms Not Available
Gene Name YWHAG
Protein Type Enzyme
Biological Properties
General Function Involved in insulin-like growth factor receptor binding
Specific Function Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner.
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 25
Locus Not Available
SNPs YWHAG
Gene Sequence Not Available
Protein Properties
Number of Residues 247
Molecular Weight 28253.0
Theoretical pI 4.52
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>14-3-3 protein gamma
MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSW
RVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQIESK
VFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYS
VFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDD
DGGEGNN
GenBank ID Protein 2852385
UniProtKB/Swiss-Prot ID P68252
UniProtKB/Swiss-Prot Entry Name 1433G_BOVIN
PDB IDs Not Available
GenBank Gene ID AF043737
GeneCard ID YWHAG
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available