You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00243
Secondary Accession Numbers None
Name 14-3-3 protein beta/alpha
Synonyms Not Available
Gene Name YWHAB
Protein Type Enzyme
Biological Properties
General Function Involved in protein domain specific binding
Specific Function Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Negative regulator of osteogenesis. Blocks the nuclear translocation of the phosphorylated form (by AKT1) of SRPK2 and antagonizes its stimulatory effect on cyclin D1 expression resulting in blockage of neuronal apoptosis elicited by SRPK2. Negative regulator of signaling cascades that mediate activation of MAP kinases via AKAP13.
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 13
Locus Not Available
SNPs YWHAB
Gene Sequence
>741 bp
ATGACCATGGATAAAAGTGAGCTGGTACAGAAAGCCAAGCTCGCCGAGCAGGCCGAGCGC
TACGATGACATGGCTGCGGCCATGAAGGCGGTCACAGAGCAGGGGCACGAGCTCTCCAAC
GAGGAGAGAAACCTGCTGTCCGTCGCCTACAAGAATGTGGTCGGCGCCCGCCGTTCGTCC
TGGCGTGTCATCTCCAGCATCGAACAGAAAACTGAGAGGAACGAGAAGAAGCAGCAGATG
GGCAAAGAGTACCGCGAGAAGATCGAGGCCGAGCTGCAGGACATCTGCAATGACGTGCTG
GAGCTGTTGGATAAATACCTTATTCCCAATGCTACACAACCAGAAAGTAAGGTGTTCTAC
TTGAAAATGAAAGGCGATTATTTTAGATATCTTTCTGAGGTGGCTTCTGGAGACAATAAA
CAAACCACTGTGTCGAACTCCCAGCAGGCTTACCAAGAAGCATTTGAAATTAGTAAGAAA
GAAATGCAGCCTACACACCCCATTCGACTGGGGCTGGCACTTAATTTCTCCGTCTTTTAT
TATGAGATTCTAAACTCTCCTGAAAAGGCTTGCAGCCTGGCAAAAACGGCGTTTGATGAG
GCGATTGCTGAATTGGACACACTGAATGAAGAGTCTTACAAAGACAGCACCCTGATTATG
CAGCTGCTTAGGGACAATCTCACTCTGTGGACGTCGGAAAACCAGGGAGACGAAGGAGAT
GCTGGGGAGGGAGAGAACTAA
Protein Properties
Number of Residues 246
Molecular Weight 28081.0
Theoretical pI 4.51
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>14-3-3 protein beta/alpha
MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSS
WRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLQLLDKYLIPNATQPESKVFY
LKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFY
YEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGD
AGEGEN
GenBank ID Protein 111307057
UniProtKB/Swiss-Prot ID P68250
UniProtKB/Swiss-Prot Entry Name 1433B_BOVIN
PDB IDs Not Available
GenBank Gene ID BC120112
GeneCard ID YWHAB
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available