You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00366
Secondary Accession Numbers None
Name 2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial
Synonyms Not Available
Gene Name GCAT
Protein Type Enzyme
Biological Properties
General Function Coenzyme transport and metabolism
Specific Function Not Available
Pathways
  • Amino-acid degradation
  • Glycine from L-threonine: step 2/2
  • L-threonine degradation via oxydo-reductase pathway
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 5
Locus Not Available
SNPs GCAT
Gene Sequence
>1260 bp
ATGTGGGCTGGCCGCGTCCTGCATGCTGCGCTCTCCCGGGCCCCCCGCGAGAGCCGGGCG
CAGTCAGCGCTGGCTCAGCTGCGTGGCATCCTGGAGGAGGAGCTGGAAAGCATCCGCGGA
GCTGGCACCTGGAAGAGCGAGCGGGTCATCACGTCCCGTCAGGGGCCGCACATCCACGTG
GACGGCGCCCCGGGAGGAATTATTAACTTCTGTGCCAACAACTACCTGGGCCTGAGCAGC
CACCCTGAGGTCATTCAGGCAGGTCTGCGGACCCTAAAGGAGTTTGGAGCCGGCCTTAGC
TCAGTCCGCTTCATCTGTGGCACCCAGAGCATCCACAAAGACCTAGAAGCAAAGATAGCC
CGCTTTCACCAAAGGGAGGATGCCATCCTCTATCCCAGCTGTTTTGATGCCAACACCGGC
CTCTTTGAGGCACTGCTGACTTCGGAGGACGCAGTCCTGTCGGATGAGCTGAACCATGCC
TCCATCATCGATGGCATCCGTCTGTGCAAGGCCCACAAGTACCGCTACCGCCACCTGGAT
ATGGCTGATCTGGAGGCCAAGCTGCAGGAGGCCCAGAAGCATCGGCTGCGCCTGGTGGCC
ACTGATGGGGCCTTTTCCATGGATGGTGACATCGCACCCCTGCAGGAGATCTGCCGCCTT
GCCTCTCAATATGGTGCCTTAGTCTTTGTGGACGAAAGCCACGCCACTGGCTTCCTGGGG
GCCACAGGACGGGGCACAGATGAGCTGCTGGGCGTGATGGACCAAGTCACCATCATCAAC
TCCACACTGGGGAAGGCCCTGGGTGGAGCATCAGGGGGCTACACGACTGGGCCTGGGGCC
CTGGTATCCCTGCTACGGCAGCGTGCCCGGCCCTACCTCTTCTCCAACAGCCTGCCCCCT
GCTGCTGTCGGCTGTGCCTCCAAGGCCCTGGACCTGCTCATGGAGAGCAACGCCATCGTC
CAGTCTATGGCGGCCAAGACCCTGCGATTCCGCAGTCAGATGGAGGCTGCTGGCTTCACC
ATCTCAGGAGCCAATCACCCCATCTGCCCTGTGATGCTGGGTGACGCTCGGCTGGCCTTA
AACATAGCGGATGACATGCTTAAGAGAGGCATCTTTGTCATTGGGTTCAGCTACCCTGTG
GTCCCCAAAGGCAAGGCCCGGATCCGAGTCCAGATCTCAGCAGTGCACAGTGAGGAGGAC
ATTGACCGCTGTGTGGAGGCCTTCGTGGAGGTGGGGCGACTGCACGGCGCGCTGCCTTGA
Protein Properties
Number of Residues 419
Molecular Weight 45166.0
Theoretical pI 7.38
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial
MWAGRVLHAALSRAPRESRAQSALAQLRGILEEELESIRGAGTWKSERVITSRQGPHIHV
DGAPGGIINFCANNYLGLSSHPEVIQAGLRTLKEFGAGLSSVRFICGTQSIHKDLEAKIA
RFHQREDAILYPSCFDANTGLFEALLTSEDAVLSDELNHASIIDGIRLCKAHKYRYRHLD
MADLEAKLQEAQKHRLRLVATDGAFSMDGDIAPLQEICRLASQYGALVFVDESHATGFLG
ATGRGTDELLGVMDQVTIINSTLGKALGGASGGYTTGPGALVSLLRQRARPYLFSNSLPP
AAVGCASKALDLLMESNAIVQSMAAKTLRFRSQMEAAGFTISGANHPICPVMLGDARLAL
NIADDMLKRGIFVIGFSYPVVPKGKARIRVQISAVHSEEDIDRCVEAFVEVGRLHGALP
GenBank ID Protein 112362358
UniProtKB/Swiss-Prot ID Q0P5L8
UniProtKB/Swiss-Prot Entry Name KBL_BOVIN
PDB IDs Not Available
GenBank Gene ID BC119870
GeneCard ID GCAT
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available