You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00639
Secondary Accession Numbers None
Name 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase
Synonyms Not Available
Gene Name ACMSD
Protein Type Enzyme
Biological Properties
General Function Involved in aminocarboxymuconate-semialdehyde decarboxy
Specific Function Converts alpha-amino-beta-carboxymuconate-epsilon-semialdehyde (ACMS) to alpha-aminomuconate semialdehyde (AMS). ACMS can be converted non-enzymatically to quinolate (QA), a key precursor of NAD, and a potent endogenous excitotoxin of neuronal cells which is implicated in the pathogenesis of various neurodegenerative disorders. In the presence of ACMSD, ACMS is converted to AMS, a benign catabolite. ACMSD ultimately controls the metabolic fate of tryptophan catabolism along the kynurenine pathway (By similarity).
Pathways
  • Quinolate metabolism
  • Secondary metabolite metabolism
  • Tryptophan Metabolism
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 2
Locus Not Available
SNPs ACMSD
Gene Sequence
>1011 bp
ATGAAGATTGACATCCACACTCATATTTTACCAAGAGAATGGCCAGACCTAAAAAAGAGA
TTCGGTTATGGAGGCTGGGTGCAGCTCCAACACAATGGCAAGGGAGAAGCAAAGATGCTG
AAAGATGGGAAGGTCTTCAGAGTGGTCCAAGAGAACTGCTGGGATCCAGAAGCTCGTCTT
AGAGAAATGGACCAAACAGGAGTGACTGTGCAAGCCCTTTCCACGGTTCCTGTCATGTTT
AGCTACTGGGCCAAACCTCAGGACACTTTAGACCTGTGCCAGCTTCTGAACAACGACCTA
GCCGCCACCATTGCGAGCCACCCCAGGAGGTTTGTGGGTCTGGGGACGTTGCCCATGCAG
GCCCCTGAGCTGGCGGTTAAGGAGATGGAGCGCTGTGTGAGGAAGTTGGGCTTTCCCGGG
GTTCAGATCGGCTCCCACATCAACGAGTGGGACCTGAACGCACGGGAACTCTTCCCAGTG
TACGCGGAGGCTGAAAGGCTGAACTGTTCCCTATTTGTGCACCCCTGGGACATGCAGATG
GATGGACGGATGGCCAAATACTGGTTCCCTTGGCTCATAGGAATGCCAGCTGAGACCACT
GCAGCCATCTGTTCCATGATCATGGGTGGAGTGTTTGAGAAGTTTCCTAAACTGAAAGTG
TGCTTTGCACATGGAGGTGGTTCCTTCCCCTTCACAGTTGGAAGAATCTCCCATGGATTC
AGCATGCGTCCTGATCTGTGTGCACAGGACAATCCAACCAACCCAAAGAAATACCTTGGT
TCCTTTTATACAGACTCCTTGGTTCATGATCCTCTGGCCCTCAAACTGTTAACAGATGTC
ATAGGAAAGGATAAAGTCATTTTGGGAACTGATTACCCCTTCCCACTAGGTGAGTTGGAA
CCTGGGAAACTGATAGAATCAATGGGAGAATTTGATGCAGAAACCAAGGATAAACTCAAA
GCTGGCAATGCCCTAGAATTTTTGGGGCTTGAAAGGAAACAATTTGAATGA
Protein Properties
Number of Residues 336
Molecular Weight 37923.0
Theoretical pI 6.78
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>2-amino-3-carboxymuconate-6-semialdehyde decarboxylase
MKIDIHTHILPREWPDLKKRFGYGGWVQLQHNGKGEAKMLKDGKVFRVVQENCWDPEARL
REMDQTGVTVQALSTVPVMFSYWAKPQDTLDLCQLLNNDLAATIASHPRRFVGLGTLPMQ
APELAVKEMERCVRKLGFPGVQIGSHINEWDLNARELFPVYAEAERLNCSLFVHPWDMQM
DGRMAKYWFPWLIGMPAETTAAICSMIMGGVFEKFPKLKVCFAHGGGSFPFTVGRISHGF
SMRPDLCAQDNPTNPKKYLGSFYTDSLVHDPLALKLLTDVIGKDKVILGTDYPFPLGELE
PGKLIESMGEFDAETKDKLKAGNALEFLGLERKQFE
GenBank ID Protein 113912074
UniProtKB/Swiss-Prot ID Q0II68
UniProtKB/Swiss-Prot Entry Name ACMSD_BOVIN
PDB IDs Not Available
GenBank Gene ID BC122781
GeneCard ID ACMSD
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available