You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00673
Secondary Accession Numbers None
Name 2-oxoglutarate and iron-dependent oxygenase domain-containing protein 1
Synonyms Not Available
Gene Name OGFOD1
Protein Type Enzyme
Biological Properties
General Function Involved in iron ion binding
Specific Function Prolyl 3-hydroxylase that catalyzes 3-hydroxylation of 'Pro-62' of small ribosomal subunit uS12 (RPS23), thereby regulating protein translation termination efficiency. Involved in stress granule formation.
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 18
Locus Not Available
SNPs OGFOD1
Gene Sequence Not Available
Protein Properties
Number of Residues 542
Molecular Weight 62747.0
Theoretical pI 4.68
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>2-oxoglutarate and iron-dependent oxygenase domain-containing protein 1
MNGKRPAEPGSDRAGKKVKKEVMAKFSDAVTEETLKKQVAEAWSRRTPFRHEAIVMDMDP
FLHCVIPNFIQSQNFLEGLQKELLNLDFHEKYNDLYKFQQSDDLKKRREPHICALRKILF
EHFRSWISDISKIDLESTIDMSCAKYEFSDALLCHDDELEGRRIAFILYLVPPWDASLGG
TLDLFSVDEHFQPKQIVKSLIPSWNTLVFFEVSPVSFHQVSEVLSEEKSRLSISGWFHGP
SLTRPPTYFEPLIARSPHIPQDHEILYDWINPTYLDMEYQAQIQEEFEESSEILLKEFLQ
PEKFAEVCEALERGRVEWSSRGPPNKRFYEKAEESQLPDILRDCMALFRSEAMFLLLSNF
TGLKLHFLAPSEDEPEDKKERDAVSAAENTEEGTSHSSSEPENSWAATSDSSLQSEGPTD
PEEDEAKKESSVPTCQGELRHWKTGHYTLIHDNSKTEFALDLLLYCGCEGWEPEYGGFTS
YIAKGEDEELLTVNPENNSLALVYRDRETLKFVKHINHRSLEQKKSFPNRTGFWDFSFVY
YE
GenBank ID Protein 75775235
UniProtKB/Swiss-Prot ID Q3MI03
UniProtKB/Swiss-Prot Entry Name OGFD1_BOVIN
PDB IDs Not Available
GenBank Gene ID BC104499
GeneCard ID OGFOD1
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available