You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00715
Secondary Accession Numbers None
Name 11-cis retinol dehydrogenase
Synonyms Not Available
Gene Name RDH5
Protein Type Enzyme
Biological Properties
General Function Lipid transport and metabolism
Specific Function Stereospecific 11-cis retinol dehydrogenase, which catalyzes the final step in the biosynthesis of 11-cis retinaldehyde, the universal chromophore of visual pigments. Also able to oxidize 9-cis-retinol and 13-cis-retinol, but not all-trans-retinol. Active in the presence of NAD as cofactor but not in the presence of NADP.
Pathways
  • Cofactor metabolism
  • Retinol Metabolism
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 5
Locus Not Available
SNPs RDH5
Gene Sequence
>957 bp
ATGTGGCTGCCTCTGCTGCTGGGTGTCTTGCTCTGGGCAGCACTGTGGTTGCTCAGGGAC
CGGCAGTGCCTGCCAGCCAGCGATGCCTTTATCTTCATCACCGGCTGTGACTCGGGCTTT
GGGCGGCTCCTTGCTCTGAGGCTGGACCAGAGAGGCTTCCGAGTACTGGCCAGCTGCCTG
ACACCCTCGGGGGCGGAGGACCTCCAGCGGGTCGCCTCCTCCCGCCTCCACACCACCCTG
CTGGATGTCACAGATCCCCAGAGCATCCGGCAGGCAGTCAAGTGGGTGGAAACGCATGTT
GGGGAAGCAGGGCTTTTTGGTCTGGTGAATAATGCTGGTGTGGCTGGCATCATTGGTCCC
ACCCCATGGCAGACGCGGGAGGACTTCCAGCGGGTGCTGAATGTGAACACGCTGGGTCCC
ATCGGGGTCACCCTCGCCCTGCTGCCCCTGCTGCTGCAGGCCCGGGGCCGAGTGATCAAC
ATCACCAGTGTCCTTGGCCGTCTGGCAGCCAATGGAGGGGGCTACTGCGTCTCCAAGTTT
GGCCTGGAGGCCTTCTCTGACAGCCTGAGGCGAGATGTGGCTCCTTTTGGGGTACGGGTC
TCTATCGTGGAACCTGGCTTCTTCCGAACCCCTGTGACAAACCTGGAAACTTTGGAGGAC
ACCCTGCAGGCCTGCTGGGCACGGCTGCCTCCAGCCACACAGGCCCTCTATGGGGAGGCC
TTCCTCACCAAATACCTGAGAGTGCAGCAACGTATCATGAACATGATCTGTGATCCGGAC
CTGGCCAAGGTGAGCAGGTGCCTGGAGCATGCCCTAACTGCCCGTCACCCCAGAACCCGC
TACAGCCCAGGCTGGGATGCCAAGCTGCTCTGGTTGCCAGCCTCCTACTTGCCAGCCAGG
CTGGTGGATGCTGTGCTCGCCTGGGTCCTTCCCAAGCCTGCCCAGACAGTCTACTAA
Protein Properties
Number of Residues 318
Molecular Weight 35037.0
Theoretical pI 9.1
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>11-cis retinol dehydrogenase
MWLPLLLGVLLWAALWLLRDRQCLPASDAFIFITGCDSGFGRLLALRLDQRGFRVLASCL
TPSGAEDLQRVASSRLHTTLLDVTDPQSIRQAVKWVETHVGEAGLFGLVNNAGVAGIIGP
TPWQTREDFQRVLNVNTLGPIGVTLALLPLLLQARGRVINITSVLGRLAANGGGYCVSKF
GLEAFSDSLRRDVAPFGVRVSIVEPGFFRTPVTNLETLEDTLQACWARLPPATQALYGEA
FLTKYLRVQQRIMNMICDPDLAKVSRCLEHALTARHPRTRYSPGWDAKLLWLPASYLPAR
LVDAVLAWVLPKPAQTVY
GenBank ID Protein 663171
UniProtKB/Swiss-Prot ID Q27979
UniProtKB/Swiss-Prot Entry Name RDH1_BOVIN
PDB IDs Not Available
GenBank Gene ID X82262
GeneCard ID RDH5
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available