You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP01017
Secondary Accession Numbers None
Name 15-hydroxyprostaglandin dehydrogenase [NAD+]
Synonyms Not Available
Gene Name HPGD
Protein Type Enzyme
Biological Properties
General Function Lipid transport and metabolism
Specific Function Prostaglandin inactivation. Contributes to the regulation of events that are under the control of prostaglandin levels. Catalyzes the NAD-dependent dehydrogenation of lipoxin A4 to form 15-oxo-lipoxin A4 (By similarity).
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 8
Locus Not Available
SNPs HPGD
Gene Sequence
>801 bp
ATGCACGTGAACGGCAAAGTGGCGCTGGTGACTGGCGCGGCCCAGGGCATCGGGCGAGCC
TTCGCCGAGGCGCTGCTGCTCAAGGGCGCCAAGGTAGCGCTGGTCGATTGGAATCTCGAA
GCAGGTGTCAAGTGTAAAGCCGCCCTGGATGAGCAGTTTGAACCTCAGAAGACTCTCTTT
ATTCAGTGCGATGTGGCCGATCAGGAACAACTGAGAGATACTTTTAGGAAAGTTGTAGAC
CACTTTGGAAAGCTGGACATCTTGGTCAATAATGCTGGAGTGAATAATGAGAAAAACTGG
GAAAAAACTCTGCAGATTAATTTGGTTTCTGTGATCAGTGGAACCTACCTGGGCTTGGAT
TACATGAGCAAGCAAAATGGAGGCGAAGGTGGCATCAATATTAATATGTCCTCGTTAGCA
GGGCTCATGCCTGTTGCACAGCAGCCTGTTTATTGTGCTTCAAAACATGGCATAGTTGGA
TTCACACGCTCGGCAGCGATGGCTGCTAATCTCATGAACAGTGGTGTGAGACTGAACGCA
ATTTGCCCAGGCTTTGTTGATACGCCCATCCTCAAATCCATTGAAAAAGAAGAAAACATG
GGGAAATATATAGAATACATGGGTCCTATCAAGGATATGATGAAATACTATGGAATTTTG
GACCCTTCAATGATTGCCAATGGATTAATAACACTCATCGAGGATGATGCTTTGAATGGT
GCTATTATGAAGATCACAACTTCTAAGGGAATTCATTTTCAAGATTACGACACAACCCCA
TTTCACATGAAAATGCAGTGA
Protein Properties
Number of Residues 266
Molecular Weight 29026.0
Theoretical pI 6.36
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>15-hydroxyprostaglandin dehydrogenase [NAD+]
MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVKCKAALDEQFEPQKTLF
IQCDVADQEQLRDTFRKVVDHFGKLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLD
YMSKQNGGEGGININMSSLAGLMPVAQQPVYCASKHGIVGFTRSAAMAANLMNSGVRLNA
ICPGFVDTPILKSIEKEENMGKYIEYMGPIKDMMKYYGILDPSMIANGLITLIEDDALNG
AIMKITTSKGIHFQDYDTTPFHMKMQ
GenBank ID Protein 74267692
UniProtKB/Swiss-Prot ID Q3T0C2
UniProtKB/Swiss-Prot Entry Name PGDH_BOVIN
PDB IDs Not Available
GenBank Gene ID BC102458
GeneCard ID HPGD
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available