You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP01030
Secondary Accession Numbers None
Name 17-beta-hydroxysteroid dehydrogenase 14
Synonyms Not Available
Gene Name HSD17B14
Protein Type Enzyme
Biological Properties
General Function Lipid transport and metabolism
Specific Function Has NAD-dependent 17-beta-hydroxysteroid dehydrogenase activity. Converts oestradiol to oestrone. The physiological substrate is not known. Acts on oestradiol and 5-androstene-3-beta,17-beta-diol (in vitro) (By similarity).
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 18
Locus Not Available
SNPs HSD17B14
Gene Sequence
>813 bp
ATGGCAATGGGAACGCGCTATGCTGGGAAGGTGGTCATCGTGACCGGCGGCGGCCGCGGC
ATAGGAGCCGGGATCGTTCGAGCTTTCGTGGAAAGCGGTGCACAAGTGGTTATCTGTGAC
AAAGATGAGGCCAGGGGCAGGGCGGTGGAGCGAGAGCTTCCTGGCACTGTCTTTCTGCTC
TGTGACGTGACTCGGGAGGAAGATGTGAGGACCCTCGTTTCTGAGACCATCCGCCGTTTT
GGCCGCCTGGATTGCATAGTCAACAACGCTGGCTACCACCCACCCCCACAGTGGCCCGAG
GAGACCTCCGCCCAGGGCTTTCGCCAGCTGCTGGAGCTGAACCTGCTGGGGACATACACC
CTGACCAAGCTCGCCCTCCCTCACCTGCGCAAGAGCCGGGGAAATGTCATCAACATCTCC
AGCCTGGTTGGGGCGATTGGCCAGTCCCAAGCGGTTCCCTACGTGGCCACCAAGGGGGCA
GTGACAGCAATGACCAAAGCCTTGGCCCTGGATGAGAGTCAGTATGGCGTCCGTGTCAAC
TGCATCTCCCCTGGAAACATCTGGACCCCTCTGTGGGAAGAGCTGGCGGCCTCAACACCT
GACCCCACTGCTACAATCCGAGAGGGCACTCTGGCCCAGCCCCTGGGCCGCATGGGCCAG
CCAGCTGAGGTGGCGGCTGCTGCTGTGTTCTTGGCCTCCGAAGCCACCTTCTGCACGGGG
ACTGAGCTGCTCGTGACCGGGGGTGCGGAGCTGGGGTATGGGCGCAAGGCAGGCCAGGCC
GCCCCGGCGGAGGCCCCCACCACCCCTTCCTGA
Protein Properties
Number of Residues 270
Molecular Weight 28421.0
Theoretical pI 6.52
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>17-beta-hydroxysteroid dehydrogenase 14
MAMGTRYAGKVVIVTGGGRGIGAGIVRAFVESGAQVVICDKDEARGRAVERELPGTVFLL
CDVTREEDVRTLVSETIRRFGRLDCIVNNAGYHPPPQWPEETSAQGFRQLLELNLLGTYT
LTKLALPHLRKSRGNVINISSLVGAIGQSQAVPYVATKGAVTAMTKALALDESQYGVRVN
CISPGNIWTPLWEELAASTPDPTATIREGTLAQPLGRMGQPAEVAAAAVFLASEATFCTG
TELLVTGGAELGYGRKAGQAAPAEAPTTPS
GenBank ID Protein 7416995
UniProtKB/Swiss-Prot ID Q9MYP6
UniProtKB/Swiss-Prot Entry Name DHB14_BOVIN
PDB IDs Not Available
GenBank Gene ID AF202997
GeneCard ID HSD17B14
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available