You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP01245
Secondary Accession Numbers None
Name 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase
Synonyms Not Available
Gene Name ADI1
Protein Type Enzyme
Biological Properties
General Function Involved in nickel ion binding
Specific Function Catalyzes the formation of formate and 2-keto-4-methylthiobutyrate (KMTB) from 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene). Also down-regulates cell migration mediated by MMP14.
Pathways
  • Amino-acid biosynthesis
  • L-methionine biosynthesis via salvage pathway
  • L-methionine from S-methyl-5-thio-alpha-D-ribose 1-phosphate: step 5/6
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 8
Locus Not Available
SNPs ADI1
Gene Sequence
>540 bp
ATGGTGGAGGCCTGGTACATAGACGATGCGGCCGACGACCCGCGGCTGCCGCACCGCGCC
GAGCCCGCGCGCCCTGTCGGCCTGGAGCAGCTGCGCCGGCTCGGGGTCCTTTACTGGAAG
CTGGATGCAGACAAATACGAGAACGATCCAGAATTAGAGAAGATCCGCAAAGAGAGAAAC
TACTCCTGGGTGGACATCATAACCATAAGCAAAGACAAACTACCGAATTACGAGGAAAAG
ATCAAGATGTTCTTTGAGGAGCACTTACACCTGGACGAGGAGATCCGCTACATCCTGGAC
GGCAGCGGGTACTTTGACGTGCGGGACCAGGAGGACCGCTGGATCCGGATCTCCATGGAG
AAGGGGGACATGATCACCCTGCCCGCCGGCATCTACCACCGCTTCACGCTGGACGAGAAG
AACTACGTGAAGGCCATGCGGCTGTTCGTGGGAGACCCCGTGTGGACGCCATACAACCGG
CCGTCGGACCACCTCGAGGCCCGGACGCAATACCTGGAGTTCCTGGCGCAGTCGGCCTAG
Protein Properties
Number of Residues 179
Molecular Weight 21487.0
Theoretical pI 4.8
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase
MVEAWYIDDAADDPRLPHRAEPARPVGLEQLRRLGVLYWKLDADKYENDPELEKIRKERN
YSWVDIITISKDKLPNYEEKIKMFFEEHLHLDEEIRYILDGSGYFDVRDQEDRWIRISME
KGDMITLPAGIYHRFTLDEKNYVKAMRLFVGDPVWTPYNRPSDHLEARTQYLEFLAQSA
GenBank ID Protein 73586832
UniProtKB/Swiss-Prot ID Q3ZBL1
UniProtKB/Swiss-Prot Entry Name MTND_BOVIN
PDB IDs Not Available
GenBank Gene ID BC103235
GeneCard ID ADI1
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available