You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP01369
Secondary Accession Numbers None
Name 1-aminocyclopropane-1-carboxylate synthase-like protein 1
Synonyms Not Available
Gene Name ACCS
Protein Type Enzyme
Biological Properties
General Function Amino acid transport and metabolism
Specific Function Does not catalyze the synthesis of 1-aminocyclopropane-1-carboxylate but is capable of catalyzing the deamination of L-vinylglycine.
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 15
Locus Not Available
SNPs ACCS
Gene Sequence
>1509 bp
ATGTTCACCCTCCCTCAGAAGGAATTCAGGATGACTACCGCCTGTCCAGGTTCAGACTCC
ATACAGGACCTGCCCAGTAACAAGGGAGATGGTCTGGAAAGAGAATGCTCCAGAAAACCC
GACCAGAAGCTGCTGAAGTTCTATGGAGTGGGTGACCCCGCTGCCGAGCTCTCCTCCAGC
AGCCCCTACCTGTCCTCTAGAGGCAGCGTCATTAAATGGTTCTGGGATTCAGCGGAGGAG
GGCTACAGGACCTACCACATGGATGAATATGATGAGGACAAGAACCCCAGTGGCATCATT
AACTTGGGCACCAGTGAGAACAAACTCTGCTTTGACCTGCTGTCCAGACGGCTGAGTCAG
AGTGACATGCTGCAGGTGGAGCCGGCCCTGTTGCAGTACCCCGACTGGAGGGGACATCTG
TTCCTCCGGGAGGAAGTGGCCAGGTTCCTATCTTTCTACTGCAGAAGCCCCGCACCCCTT
AAACCGGAGAATGTGGTTGTTCTGAACGGCTGTGCCTCTCTCTTCTCTGCTCTGGCCACG
GTGCTGTGTGAGGCAGGAGAGGCTTTCCTGATCCCTGCCCCTTACTATGGAGCCATCACA
CAGCACGTGTATCTCTATGGCAACGTCCGACTGGTCTGTGTCTATCTGGACAGTGAGGTC
ACTGGGCTGGAAACACGCCCCTTCCAGCTCACAGTGGAGAAGCTGGAGATGGCCCTGCAA
GGAGCTAATTCTGAGGGTGTGAAGGTCAAAGGCCTCATCCTCATCAACCCCCAGAATCCT
CTGGGTGACATCTATTCCCCAGGGGAGCTGCAGGAGTACCTGGAGTTTGCCAAGAGGCAC
GAGCTGCACGTGATGGTGGACGAGGTCTACATGCTGTCCGTGTTTGAGGAGTCAGCTGGG
TACCGCAGTGTCCTGAGCCTGGAAAGGCTGCCTGACCCCCAGAGGACCCACGTGATGTGG
GCGACCAGCAAGGACTTCGGGATGTCTGGGCTCCGCTTCGGCACGCTGTACACGGAAAAC
TGGGCCGTGGCCACGGCGGTGGCCTCCCTGTGCCGCTATCACGGCCTCAGTGGCCTGGTC
CAGTACCAGATGGCACAGCTGCTCCGGGACCATGACTGGATCAACCAAGTGTATCTGCCA
GAAAACCACGCCCGGCTCAAGGCTGCCCACACCTATGTCTCTGAGGACCTCCGGGCCCTG
GGTATCCCCTTCGTGAGCCGTGGGGCCGGCTTCTTCATCTGGGTCGACTTGAGGAAGTAC
CTGCCCGAGGCCACCTTTGAGGAGGAGGTGCTGCTCTGGCGTCGATTTTTGGAGAACAAG
GTGCTGCTGTCCTTTGGCAAAGCCTTTGAGTGCAAAGAGCCCGGCTGGTTCCGCTTGGTC
TTCTCGGACAAGACCCACCGGCTTCACCTGGGGATGCAGAGGGTCCGACAGGTGCTTGAG
GGCCAACCCCAGCTGGCAGACGGCGCCCCTCCCCACCAGATCCAGGAGCCACAAGGCCCC
CACAGGTGA
Protein Properties
Number of Residues 502
Molecular Weight 57066.0
Theoretical pI 5.9
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>1-aminocyclopropane-1-carboxylate synthase-like protein 1
MFTLPQKEFRMTTACPGSDSIQDLPSNKGDGLERECSRKPDQKLLKFYGVGDPAAELSSS
SPYLSSRGSVIKWFWDSAEEGYRTYHMDEYDEDKNPSGIINLGTSENKLCFDLLSRRLSQ
SDMLQVEPALLQYPDWRGHLFLREEVARFLSFYCRSPAPLKPENVVVLNGCASLFSALAT
VLCEAGEAFLIPAPYYGAITQHVYLYGNVRLVCVYLDSEVTGLETRPFQLTVEKLEMALQ
GANSEGVKVKGLILINPQNPLGDIYSPGELQEYLEFAKRHELHVMVDEVYMLSVFEESAG
YRSVLSLERLPDPQRTHVMWATSKDFGMSGLRFGTLYTENWAVATAVASLCRYHGLSGLV
QYQMAQLLRDHDWINQVYLPENHARLKAAHTYVSEDLRALGIPFVSRGAGFFIWVDLRKY
LPEATFEEEVLLWRRFLENKVLLSFGKAFECKEPGWFRLVFSDKTHRLHLGMQRVRQVLE
GQPQLADGAPPHQIQEPQGPHR
GenBank ID Protein 59858261
UniProtKB/Swiss-Prot ID Q5E9H2
UniProtKB/Swiss-Prot Entry Name 1A1L1_BOVIN
PDB IDs Not Available
GenBank Gene ID BT020948
GeneCard ID ACCS
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available