You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP01419
Secondary Accession Numbers None
Name 14-3-3 protein theta
Synonyms Not Available
Gene Name YWHAQ
Protein Type Enzyme
Biological Properties
General Function Involved in protein domain specific binding
Specific Function Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Negatively regulates the kinase activity of PDPK1 (By similarity).
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 11
Locus Not Available
SNPs YWHAQ
Gene Sequence
>738 bp
ATGGAGAAGACGGAGCTGATCCAGAAGGCCAAGCTGGCCGAGCAGGCCGAGCGCTACGAC
GACATGGCCACCTGCATGAAGGCCGTGACGGAGCAGGGCGCCGAGCTGTCCAACGAAGAG
CGCAACCTGCTGTCGGTGGCCTACAAGAACGTGGTCGGGGGCCGCCGGTCCGCCTGGAGG
GTCATCTCCAGCATCGAGCAGAAGACCGACACCTCGGACAAGAAGTTGCAGCTGATCAAG
GACTACCGGGAGAAAGTGGAGTCCGAGCTGAGGTCCATCTGCACCACGGTCCTGGAATTG
TTGGATAAGTATTTAATAGCCAATGCAACTAATCCAGAGAGTAAGGTCTTCTATCTGAAA
ATGAAGGGAGATTACTTCCGGTACCTTGCTGAAGTTGCTTGTGGTGATGATCGGAAGCAA
ACGATAGATAATTCCCAAGGAGCTTACCAAGAGGCTTTCGATATAAGCAAGAAAGAGATG
CAACCCACACACCCCATCCGGCTGGGGCTGGCTCTTAACTTTTCTGTGTTCTACTATGAG
ATCCTCAATAACCCGGAACTGGCCTGCACACTGGCTAAAACGGCTTTTGATGAGGCTATT
GCAGAACTCGACACACTGAATGAAGACTCGTACAAAGACAGCACCCTCATCATGCAGCTG
CTGAGAGACAACCTCACATTATGGACATCAGACAGTGCAGGAGAAGAATGTGATGCGGCA
GAAGGGGCAGAAAACTAA
Protein Properties
Number of Residues 245
Molecular Weight 27764.0
Theoretical pI 4.41
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>14-3-3 protein theta
MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWR
VISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLK
MKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYE
ILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAA
EGAEN
GenBank ID Protein 152941256
UniProtKB/Swiss-Prot ID Q3SZI4
UniProtKB/Swiss-Prot Entry Name 1433T_BOVIN
PDB IDs Not Available
GenBank Gene ID BT030749
GeneCard ID YWHAQ
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available