You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP01420
Secondary Accession Numbers None
Name 14-3-3 protein epsilon
Synonyms Not Available
Gene Name YWHAE
Protein Type Enzyme
Biological Properties
General Function Not Available
Specific Function Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways (PubMed:7931346). Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif (PubMed:7931346). Binding generally results in the modulation of the activity of the binding partner (PubMed:7931346). Positively regulates phosphorylated protein HSF1 nuclear export to the cytoplasm (By similarity).
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 19
Locus Not Available
SNPs YWHAE
Gene Sequence
>768 bp
ATGGATGATCGGGAGGATCTGGTGTACCAGGCGAAGCTGGCCGAGCAGGCTGAGCGATAC
GACGAAATGGTGGAGTCAATGAAGAAAGTAGCAGGGATGGATGTGGAGTTGACAGTTGAA
GAAAGAAACCTCCTATCTGTTGCATATAAAAATGTGATTGGAGCTAGAAGAGCTTCCTGG
AGAATAATCAGCAGCATTGAACAGAAAGAAGAAAACAAGGGAGGAGAAGACAAACTAAAA
ATGATTCGGGAATATCGGCAAATGGTTGAGACTGAGCTAAAGTTAATCTGTTGTGACATT
CTGGATGTACTGGACAAACACCTCATTCCAGCAGCTAACACTGGCGAGTCCAAGGTTTTC
TATTATAAAATGAAAGGGGACTACCACAGGTATCTGGCTGAATTTGCCACAGGGAATGAC
AGGAAGGAGGCTGCGGAGAACAGCCTAGTGGCTTATAAAGCTGCTAGTGATATTGCAATG
ACAGAACTTCCACCAACACATCCCATTCGCTTAGGTCTTGCTCTCAACTTTTCTGTATTC
TACTATGAAATTCTTAATTCCCCTGACCGTGCCTGCAGGTTGGCAAAAGCAGCTTTTGAT
GATGCAATTGCAGAACTGGACACGCTGAGTGAAGAAAGCTATAAGGACTCTACACTTATC
ATGCAGTTGTTACGTGATAATCTGACACTATGGACTTCAGACATGCAGGGTGATGGTGAA
GAGCAGAATAAAGAAGCGCTGCAGGATGTGGAAGATGAAAATCAGTGA
Protein Properties
Number of Residues 255
Molecular Weight 29174.0
Theoretical pI 4.36
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>14-3-3 protein epsilon
MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASW
RIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVF
YYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVF
YYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGE
EQNKEALQDVEDENQ
GenBank ID Protein 3676399
UniProtKB/Swiss-Prot ID P62261
UniProtKB/Swiss-Prot Entry Name 1433E_BOVIN
PDB IDs Not Available
GenBank Gene ID AF043735
GeneCard ID YWHAE
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available