You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP01421
Secondary Accession Numbers None
Name 14-3-3 protein sigma
Synonyms Not Available
Gene Name SFN
Protein Type Enzyme
Biological Properties
General Function Involved in protein domain specific binding
Specific Function Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. When bound to KRT17, regulates protein synthesis and epithelial cell growth by stimulating Akt/mTOR pathway. May also regulate MDM2 autoubiquitination and degradation and thereby activate p53/TP53 (By similarity).
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 2
Locus Not Available
SNPs SFN
Gene Sequence
>747 bp
ATGGAGAGAGCCAGTCTGATCCAGAAGGCCAAGTTGGCCGAGCAGGCCGAACGCTATGAA
GACATGGCAGCTTTCATGAAGAGCGCGGTGGAAAAGGGTGAAGAGCTATCCTGCGAAGAG
CGCAACCTGCTCTCAGTGGCCTACAAGAACGTGGTGGGTGGCCAGCGGGCGGCGTGGAGG
GTCCTGTCCAGTATCGAGCAAAAGAGCAATGAAGAAAGCTCGGAAGAGAAGGGCCCGGAG
GTGCAAGAGTACCGGGAGAAGGTGGAGACGGAGCTCCGGGGTGTGTGTGACACAGTGCTG
GGCTTGCTGGACACCCACCTCATCAAGGAGGCCGGTGACGCCGAAAGTCGGGTCTTCTAC
CTGAAAATGAAGGGCGACTACTACCGCTACCTGGCCGAAGTGGCCACTGGCGACGACAAG
AAGCGCATCATCGACTCAGCCCGGTCGGCCTACCAGGAGGCCATGGACATCAGCAAGAAG
GAGATGCCGCCCACCAACCCCATCCGCCTGGGCCTGGCCCTGAACTTTTCCGTCTTCCAC
TATGAGATCGCCAACAGCCCCGAGGAAGCCATCTCTCTGGCCAAGACCACCTTCGACGAG
GCCATGGCCGACCTGCACACCCTCAGCGAGGACTCCTACAAAGACAGCACCCTCATCATG
CAGCTGTTGCGAGACAACCTGACGCTGTGGACGGCCGACAACGCCGGGGAAGAAGGGGGC
GAGGCTCCCGAGGAGCCCCAGAGCTGA
Protein Properties
Number of Residues 248
Molecular Weight 27849.0
Theoretical pI 4.36
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>14-3-3 protein sigma
MERASLIQKAKLAEQAERYEDMAAFMKSAVEKGEELSCEERNLLSVAYKNVVGGQRAAWR
VLSSIEQKSNEESSEEKGPEVQEYREKVETELRGVCDTVLGLLDTHLIKEAGDAESRVFY
LKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFH
YEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGG
EAPEEPQS
GenBank ID Protein 111305346
UniProtKB/Swiss-Prot ID Q0VC36
UniProtKB/Swiss-Prot Entry Name 1433S_BOVIN
PDB IDs
GenBank Gene ID BC120373
GeneCard ID SFN
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available