You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP01623
Secondary Accession Numbers None
Name 15 kDa selenoprotein
Synonyms Not Available
Gene Name 15-Sep
Protein Type Enzyme
Biological Properties
General Function Involved in selenium binding
Specific Function May be involved in redox reactions associated with the formation of disulfide bonds. May contribute to the quality control of protein folding in the endoplasmic reticulum (By similarity).
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 3
Locus Not Available
SNPs 15-Sep
Gene Sequence
>489 bp
ATGGCGGCCCGGCGGGATGGATGGCTTGGCCCGGCGTTTGGGCTGCGACTGCTGCTGGCG
ACCGTGCTTCAAACGGTCTCTGCATTGGGAGCAGAATTTTCCTCAGAGTCTTGCAGAGAG
TTAGGTTTCTCCAGCAACTTGCTCTGCAGCTCCTGTGATTTGCTTGGACAGTTCAACCTT
CTGCAGCTGGATCCTGACTGTAGAGGGTGCTGTCAGGAAGAAGCACAATTTGAAACTAAA
AAGCTGTATGCAGGAGCTATTCTTGAAGTCTGTGGATGAAAATTGGGGAGGTTCCCTCAA
GTCCAAGCTTTCGTCAGGAGTGATAAACCCAAGCTATTCAAAGGACTACAAATCAAGTAT
GTTCGCGGTTCAGACCCTGTGCTAAAGCTTTTGGACGACAGTGGGAACATTGCTGAAGAA
CTAAGCATCCTCAAATGGAACACAGACAGTGTAGAAGAATTCCTGAGTGAAAAGTTGGAA
CGCATATAA
Protein Properties
Number of Residues 162
Molecular Weight 17975.0
Theoretical pI 4.84
Pfam Domain Function Not Available
Signals
  • 28-Jan
Transmembrane Regions Not Available
Protein Sequence
>15 kDa selenoprotein
MAARRDGWLGPAFGLRLLLATVLQTVSALGAEFSSESCRELGFSSNLLCSSCDLLGQFNL
LQLDPDCRGCCQEEAQFETKKLYAGAILEVCGUKLGRFPQVQAFVRSDKPKLFKGLQIKY
VRGSDPVLKLLDDSGNIAEELSILKWNTDSVEEFLSEKLERI
GenBank ID Protein 158454994
UniProtKB/Swiss-Prot ID A8YXY3
UniProtKB/Swiss-Prot Entry Name SEP15_BOVIN
PDB IDs Not Available
GenBank Gene ID BC102886
GeneCard ID 15-Sep
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available