You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP02324
Secondary Accession Numbers None
Name 100125581 protein
Synonyms Not Available
Gene Name 100125581
Protein Type Enzyme
Biological Properties
General Function Involved in transcription factor activity
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location Un|119924361
Locus Not Available
SNPs 100125581
Gene Sequence
>1524 bp
ATGAGCCCTGTGAAGGCGCCTGCATGCTTGTACCCACATGTGGAGGTTTTACAGGGGACT
AAGAGGTCTGTGAAAGAGAGTTCCAATAAGAGTAAGAAATCCAGCCCACAGATGGGCAGT
CTTCATCCTGAGAGTGCTCGCCAGCACTTCCGGAGATTCTGTTACCATGACACACCTGGA
CCGTATGAGGCTGTCAGCCAACTGCAGGAATTATGCTCTCAGTGGCTGAGGCCAGAGATC
CACTCAAAAGAGCAAATCTTGGAATTGCTGGTGCTGGAGCAGTTCCTGGACGTTCTGCCC
AGTCATATCCAGAACTGGGTGCAGAAGTATCAGCCACAGAACGTCAAAGAGGCTGTGGCC
CTGGTAGACCGCTTTCAGAGAGAATCTGGTGGAATAAGCAATGAGGTCACAGCCCATGAA
CTGGGAAATGACACAGCGCTCTTGGGAGGAACAGCAGTGGCCCCAGGCTTTAAGTGGAAG
CCAGCAGAGCCCCAACCAATGGGTGTGTTCCAGGAAGAATGTTCGAACATATACCAGGTA
CTGCAGGAGCTGGGCTGGAATACTCACAAAGAAAGCCAGCCTGTGGATGAAGGAGCTGTG
CCTGCTGAAGAGAGTCAAACTTTTTCTAAACAGAAAATCACCCCAAGCTGGAACATGGCA
TCTGAGCTCACCTGGCCTCAGTCCCTGAGTCCATTGACATTTGAAGATGTGGCCTTGTAT
TTTTCCGAGGAAGAATGGAAAATAATGACCCCTGATGAGAAGACCCTCTACCTTGATGTA
ATGCAGGATGTCTATGAGGATGTCGCCTCTGTAGGGTTAAAGCTCAAAAATGACACTGGA
AATGACCCACCTGTATCTCTTCCTACATTAGAGATACAACCATCAGGATGCGAAGTATTA
AGAAAGGCCACAATGAAAGATGCTGAGACAACAATGGGCGATGTAAATCATGGTGGTACA
TGCAGGGTATGGAAACGACCTCGTGCTTTTCCAGGAAGGAAAAGAAAGAAACTTAAAACT
TGTAAACAAGAGCTTCCAAAACCTGTTGATGTTCATGGGAAAGGCTGTGAGGGAGAGAAA
CCTTTTAAATGTCAGGAATGTGGAAAAAGCTTCAGAGTTAGCTCTGACCTTATTAAACAT
CAGAGGGTTCATACCGAAGAGAGACCCTATAAATGTGAACAATGTGATAAGCAGTTTAGA
TGGAGTTCAGATCTTAATAAGCACTTAATGGCACACCAAGGAATTAAACCATATAGATGC
TCATGGTGTGGAAAAAGCTTTAGTCATAACACAAATCTACACACACACCTAAGAATTCAC
ACTGGAGAGAAGCCCTTTAAATGTTATGAATGTGGGAAAAGATTCATTCAGAACTCCCAC
CTTATTAAACACCAGAGAACCCACACAGGTGAGCAGCCTTATACCTGTAGCATATGCGAC
AGAAATTTTAGCAGGCGTTCAAGCCTTCTTAGACACCAGAAACTCCACAAGAGAAGGGAA
TCATGTCCAGTGTCTCCAGTCTGA
Protein Properties
Number of Residues 507
Molecular Weight 58014.0
Theoretical pI 8.41
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>100125581 protein
MSPVKAPACLYPHVEVLQGTKRSVKESSNKSKKSSPQMGSLHPESARQHFRRFCYHDTPG
PYEAVSQLQELCSQWLRPEIHSKEQILELLVLEQFLDVLPSHIQNWVQKYQPQNVKEAVA
LVDRFQRESGGISNEVTAHELGNDTALLGGTAVAPGFKWKPAEPQPMGVFQEECSNIYQV
LQELGWNTHKESQPVDEGAVPAEESQTFSKQKITPSWNMASELTWPQSLSPLTFEDVALY
FSEEEWKIMTPDEKTLYLDVMQDVYEDVASVGLKLKNDTGNDPPVSLPTLEIQPSGCEVL
RKATMKDAETTMGDVNHGGTCRVWKRPRAFPGRKRKKLKTCKQELPKPVDVHGKGCEGEK
PFKCQECGKSFRVSSDLIKHQRVHTEERPYKCEQCDKQFRWSSDLNKHLMAHQGIKPYRC
SWCGKSFSHNTNLHTHLRIHTGEKPFKCYECGKRFIQNSHLIKHQRTHTGEQPYTCSICD
RNFSRRSSLLRHQKLHKRRESCPVSPV
GenBank ID Protein 151554364
UniProtKB/Swiss-Prot ID A6QQ06
UniProtKB/Swiss-Prot Entry Name A6QQ06_BOVIN
PDB IDs Not Available
GenBank Gene ID BC149583
GeneCard ID 100125581
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available