Identification
BMDB Protein ID BMDBP00009
Secondary Accession Numbers None
Name Succinate dehydrogenase [ubiquinone] cytochrome b small subunit
Synonyms Not Available
Gene Name SDHD
Protein Type Enzyme
Biological Properties
General Function Involved in heme binding
Specific Function Membrane-anchoring subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q).
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs SDHD
Gene Sequence Not Available
Protein Properties
Number of Residues 61
Molecular Weight 6423.0
Theoretical pI 7.63
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>Succinate dehydrogenase complex, subunit D
PAQGWCGTQHIHLSPSHHSGSKAASLHWTGERVVSVLLLGLIPAAYLNPCSAMDYSLAAT
L
GenBank ID Protein ACM69045.1
UniProtKB/Swiss-Prot ID B9W0B4
UniProtKB/Swiss-Prot Entry Name B9W0B4_BOVIN
PDB IDs Not Available
GenBank Gene ID FJ621574
GeneCard ID SDHD
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available