Showing Protein Succinate dehydrogenase [ubiquinone] cytochrome b small subunit (BMDBP00009)
Identification | |
---|---|
BMDB Protein ID | BMDBP00009 |
Secondary Accession Numbers | None |
Name | Succinate dehydrogenase [ubiquinone] cytochrome b small subunit |
Synonyms | Not Available |
Gene Name | SDHD |
Protein Type | Enzyme |
Biological Properties | |
General Function | Involved in heme binding |
Specific Function | Membrane-anchoring subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q). |
Pathways | Not Available |
Reactions | Not Available |
GO Classification | Not Available |
Cellular Location | Not Available |
Gene Properties | |
Chromosome Location | Not Available |
Locus | Not Available |
SNPs | SDHD |
Gene Sequence | Not Available |
Protein Properties | |
Number of Residues | 61 |
Molecular Weight | 6423.0 |
Theoretical pI | 7.63 |
Pfam Domain Function | Not Available |
Signals |
|
Transmembrane Regions | Not Available |
Protein Sequence |
>Succinate dehydrogenase complex, subunit D PAQGWCGTQHIHLSPSHHSGSKAASLHWTGERVVSVLLLGLIPAAYLNPCSAMDYSLAAT L |
External Links | |
GenBank ID Protein | ACM69045.1 |
UniProtKB/Swiss-Prot ID | B9W0B4 |
UniProtKB/Swiss-Prot Entry Name | B9W0B4_BOVIN |
PDB IDs | Not Available |
GenBank Gene ID | FJ621574 |
GeneCard ID | SDHD |
GenAtlas ID | Not Available |
HGNC ID | Not Available |
References | |
General References | Not Available |