Showing Protein Succinate dehydrogenase [ubiquinone] cytochrome b small subunit (BMDBP00009)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP00009 |
| Secondary Accession Numbers | None |
| Name | Succinate dehydrogenase [ubiquinone] cytochrome b small subunit |
| Synonyms | Not Available |
| Gene Name | SDHD |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Involved in heme binding |
| Specific Function | Membrane-anchoring subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q). |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | Not Available |
| Locus | Not Available |
| SNPs | SDHD |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 61 |
| Molecular Weight | 6423.0 |
| Theoretical pI | 7.63 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions | Not Available |
| Protein Sequence |
>Succinate dehydrogenase complex, subunit D PAQGWCGTQHIHLSPSHHSGSKAASLHWTGERVVSVLLLGLIPAAYLNPCSAMDYSLAAT L |
| External Links | |
| GenBank ID Protein | ACM69045.1 |
| UniProtKB/Swiss-Prot ID | B9W0B4 |
| UniProtKB/Swiss-Prot Entry Name | B9W0B4_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | FJ621574 |
| GeneCard ID | SDHD |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |