You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00014
Secondary Accession Numbers
  • BMDBP03108
Name Lanosterol 14-alpha demethylase
Synonyms Not Available
Gene Name CYP51A1
Protein Type Enzyme
Biological Properties
General Function Secondary metabolites biosynthesis, transport and catabolism
Specific Function A cytochrome P450 monooxygenase involved in sterol biosynthesis. Catalyzes 14-alpha demethylation of lanosterol and 24,25-dihydrolanosterol likely through sequential oxidative conversion of 14-alpha methyl group to hydroxymethyl, then to carboxylaldehyde, followed by the formation of the delta 14,15 double bond in the sterol core and concomitant release of formic acid. Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (CPR; NADPH-ferrihemoprotein reductase).
Pathways
  • Steroid Biosynthesis
  • Zymosterol biosynthesis
  • Zymosterol from lanosterol: step 1/6
Reactions
Lanosterin + 3 Oxygen + 3 NADPH → 4,4-Dimethylcholesta-8,14,24-trienol + Formic acid +3 NADP +4 Water details
24-Hydroxycholesterol + NADPH + Oxygen → (24R)-Cholest-5-ene-3-beta,7-alpha,24-triol + NADP + Water details
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 4
Locus Not Available
SNPs CYP51A1
Gene Sequence
>1509 bp
ATGCTGGACTTACTGCAGGCGGGCGGGTCAGTGCTGGGGCAGGCGATGGAGCAAGTAACG
GGCGGCAACCTCGCATCCATGCTGCTCATCGCCTGCGCCTTCACGCTTAGTCTGGTCTAC
CTGTTCCGCCTCGCGGTTGGCCACCTGGCCCCACCACTGCCGACTGGGGCGAAAAGTCCA
CCATACATTGTCTCTCCAATTCCATTCCTTGGACATGCTATAGCATTTGGGAAAAGTCCA
ATTGAATTCCTAGAAGATGCATATGAGAAGTATGGACCTGTATTTAGTTTTACCATGGTG
GGAAAGACGTTTACCTACCTGCTGGGGAGTGAGGCTGCTGCACTGCTTTTTAATAGTAAA
AATGAAGACTTGAATGCCGAGGAAGTCTACAGTCGTCTGACGACACCTGTGTTTGGGAAG
GGAGTTGCCTATGATGTGCCTAATACAGTTTTCTTGGAGCAGAAGAAAATGTTGAAAAGT
GGTCTTAACATAGCCCACTTTAGACAGCACGTGTCTATAATTGAAAAAGAAACAAAAGAA
TACTTTAAAAGTTGGGGAGAAAGTGGAGAAAAAAATTTGTTTGAAGCTCTTTCTGAGCTC
ATCATTTTAACAGCCAGCCATTGTTTACATGGAAAGGAAATCAGAAGTCAACTCAACGAG
AAGGTGGCACAACTGTATGCGGATTTGGATGGAGGTTTTAGCCATGCAGCCTGGCTTTTG
CCAGGCTGGCTCCCTCTGCCTAGTTTCAGACGCAGGGACAGAGCTCATCGGGAGATCAAG
AATATTTTCTACAAGGCAATCCAGAAACGCAGAGAGTCAGGAGAAAAAATTGATGACATT
CTCCAAACTTTACTAGAGTCTACTTACAAGGATGGGCGTCCTCTGACGGATGATGAAGTA
GCAGGCATGCTTATTGGACTGCTCTTGGCAGGGCAGCATACTTCTTCAACTACCAGTGCC
TGGATGGGCTTCTTTTTGGCCAGAGACAAAACACTTCAAGAAAAATGTTTCTTAGAACAG
AAAACAGTCTGTGGTGAGAATCTGCCTCCTCTGACTTATGACCAGCTCAAGGATCTCAAT
TTACTTGATCGCTGTATAAAAGAAACATTAAGACTTCGACCTCCTATAATGACCATGATG
AGACTGGCCAAAACTCCTCTGACTGTGGCAGGGTACACCATTCCTCCAGGACACCAGGTG
TGTGTGTCTCCTACTGTCAATCAGAGACTTAAAGACTCATGGGTAGAGCGTCTGGACTTC
AATCCTGACCGCTACTTAGAGGACAGCCCAGCATCAGGAGAGAAGTTTGCTTACGTGCCA
TTTGGAGCTGGGCGTCATCGTTGCATTGGGGAGAATTTTGCCTATGTTCAAATCAAGACA
ATTTGGTCCACTATGCTTCGTTTATATGAATTTGATCTCATTGATGGGTATTTTCCCACT
GTGAATTATACAACTATGATTCACACCCCTGAAAAACCCATCATCAGATACAAACGAAGA
TCAAAATGA
Protein Properties
Number of Residues 502
Molecular Weight 56596.0
Theoretical pI 8.25
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • 22-42
Protein Sequence
>Lanosterol 14-alpha demethylase
MLDLLQAGGSVLGQAMEQVTGGNLASMLLIACAFTLSLVYLFRLAVGHLAPPLPTGAKSP
PYIVSPIPFLGHAIAFGKSPIEFLEDAYEKYGPVFSFTMVGKTFTYLLGSEAAALLFNSK
NEDLNAEEVYSRLTTPVFGKGVAYDVPNTVFLEQKKMLKSGLNIAHFRQHVSIIEKETKE
YFKSWGESGEKNLFEALSELIILTASHCLHGKEIRSQLNEKVAQLYADLDGGFSHAAWLL
PGWLPLPSFRRRDRAHREIKNIFYKAIQKRRESGEKIDDILQTLLESTYKDGRPLTDDEV
AGMLIGLLLAGQHTSSTTSAWMGFFLARDKTLQEKCFLEQKTVCGENLPPLTYDQLKDLN
LLDRCIKETLRLRPPIMTMMRLAKTPLTVAGYTIPPGHQVCVSPTVNQRLKDSWVERLDF
NPDRYLEDSPASGEKFAYVPFGAGRHRCIGENFAYVQIKTIWSTMLRLYEFDLIDGYFPT
VNYTTMIHTPEKPIIRYKRRSK
GenBank ID Protein AAY82452.1
UniProtKB/Swiss-Prot ID Q4PJW3
UniProtKB/Swiss-Prot Entry Name CP51A_BOVIN
PDB IDs Not Available
GenBank Gene ID DQ078267
GeneCard ID CYP51A1
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available