Showing Protein Cytochrome c oxidase subunit 1 (BMDBP00027)
Identification | |
---|---|
BMDB Protein ID | BMDBP00027 |
Secondary Accession Numbers | None |
Name | Cytochrome c oxidase subunit 1 |
Synonyms | Not Available |
Gene Name | COXI |
Protein Type | Enzyme |
Biological Properties | |
General Function | Energy production and conversion |
Specific Function | Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix. |
Pathways |
|
Reactions | Not Available |
GO Classification | Not Available |
Cellular Location | Not Available |
Gene Properties | |
Chromosome Location | Not Available |
Locus | Not Available |
SNPs | COXI |
Gene Sequence | Not Available |
Protein Properties | |
Number of Residues | 189 |
Molecular Weight | 20164.0 |
Theoretical pI | 5.43 |
Pfam Domain Function | Not Available |
Signals |
|
Transmembrane Regions |
|
Protein Sequence |
>Cytochrome c oxidase subunit 1 GTALSLLIRAELGQPGTLLGDDQIYNVVVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGA PDMAFPRMNNMSFWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFS LHLAGVSSILGAINFITTIINMKPPAMSQYQTPLFVWSVMITAVLLLLSLPVLAAGITML LTDRNLNTT |
External Links | |
GenBank ID Protein | ABQ81569.1 |
UniProtKB/Swiss-Prot ID | A5YMV6 |
UniProtKB/Swiss-Prot Entry Name | A5YMV6_BOVIN |
PDB IDs | |
GenBank Gene ID | EF568660 |
GeneCard ID | COXI |
GenAtlas ID | Not Available |
HGNC ID | Not Available |
References | |
General References | Not Available |