You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00041
Secondary Accession Numbers
  • BMDBP03090
Name Cytochrome P450 2D14
Synonyms Not Available
Gene Name CYP2D14
Protein Type Enzyme
Biological Properties
General Function Secondary metabolites biosynthesis, transport and catabolism
Specific Function Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics.
Pathways Not Available
Reactions
Arachidonic acid + Oxygen → 19(S)-HETE + Water details
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 5
Locus Not Available
SNPs CYP2D14
Gene Sequence Not Available
Protein Properties
Number of Residues 500
Molecular Weight 56083.0
Theoretical pI 6.74
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>Cytochrome P450 2D14
MGLLSGDTLGPLAVALLIFLLLLDLMHRRSRWAPRYPPGPTPLPVLGNLLQVDFEDPRPS
FNQLRRRFGNVFSLQQVWTPVVVLNGLAAVREALVYRSQDTADRPPPAVYEHLGYGPRAE
GVILARYGDAWREQRRFSLTTLRNFGLGKKSLEQWVTEEASCLCAAFADQAGRPFSPMDL
LNKAVSNVIASLTFGCRFEYNDPRIIKLLDLTEDGLKEEFNLVRKVVEAVPVLLSIPGLA
ARVFPAQKAFMALIDELIAEQKMTRDPTQPPRHLTDAFLDEVKEAKGNPESSFNDENLRL
VVADLFSAGMVTTSTTLAWALLLMILHPDVQRRVQQEIDEVIGQVRRPEMGDQALMPFTV
AVVHEVQRFADIVPLGLPHMTSRDIEVQGFHIPKGTTLITNLSSVLKDETVWEKPFRFHP
EHFLDAQGRFVKQEAFIPFSAGRRACLGEPLARMELFLFFTSLLQHFSFSVPAGQPRPSE
HGVFAFLVTPAPYQLCAVPR
GenBank ID Protein CAA48149.1
UniProtKB/Swiss-Prot ID Q01361
UniProtKB/Swiss-Prot Entry Name CP2DE_BOVIN
PDB IDs Not Available
GenBank Gene ID X68013
GeneCard ID CYP2D14
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available