Identification
BMDB Protein ID BMDBP00051
Secondary Accession Numbers None
Name Cytochrome c oxidase subunit 1
Synonyms Not Available
Gene Name COI
Protein Type Enzyme
Biological Properties
General Function Energy production and conversion
Specific Function Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.
Pathways
  • Energy metabolism
  • Oxidative phosphorylation
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs COI
Gene Sequence Not Available
Protein Properties
Number of Residues 236
Molecular Weight 25438.0
Theoretical pI 4.89
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • 43-68
  • 89-113
  • 133-156
  • 168-195
  • 215-233
Protein Sequence
>Cytochrome c oxidase subunit 1
GTLYLLFGAWAGMVGTALSLLIRAELGQPGTLLGDDQIYNVVVTAHAFVMIFFMVMPIMI
GGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGN
LAHAGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMSQYQTPLFVWSVMITAVLL
LLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGHPEVYILILPGF
GenBank ID Protein ACR83868.1
UniProtKB/Swiss-Prot ID C5IS85
UniProtKB/Swiss-Prot Entry Name C5IS85_BOVIN
PDB IDs
GenBank Gene ID FJ958335
GeneCard ID COI
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available