You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00052
Secondary Accession Numbers None
Name Cytochrome c oxidase subunit 1
Synonyms Not Available
Gene Name COXI
Protein Type Enzyme
Biological Properties
General Function Energy production and conversion
Specific Function Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.
Pathways
  • Energy metabolism
  • Oxidative phosphorylation
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs COXI
Gene Sequence Not Available
Protein Properties
Number of Residues 182
Molecular Weight 19520.0
Theoretical pI 5.43
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • 18-48
  • 69-93
  • 113-136
  • 148-175
Protein Sequence
>Cytochrome c oxidase subunit 1
LIRAELGQPGTLLGDDQIYNVVVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFP
RMNNMSFWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGV
SSILGAINFITTIINMKPPAMSQYQTPLFVWSVMITAVLLLLSLPVLAAGITMLLTDRNL
NT
GenBank ID Protein ABQ81614.1
UniProtKB/Swiss-Prot ID A5YN01
UniProtKB/Swiss-Prot Entry Name A5YN01_BOVIN
PDB IDs
GenBank Gene ID EF568705
GeneCard ID COXI
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available