You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00062
Secondary Accession Numbers
  • BMDBP03088
Name Cytochrome P450 2E1
Synonyms Not Available
Gene Name CYP2E1
Protein Type Enzyme
Biological Properties
General Function Secondary metabolites biosynthesis, transport and catabolism
Specific Function A cytochrome P450 monooxygenase involved in the metabolism of fatty acids. Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (NADPH--hemoprotein reductase). Catalyzes the hydroxylation of carbon-hydrogen bonds. Hydroxylates fatty acids specifically at the omega-1 position displaying the highest catalytic activity for saturated fatty acids. May be involved in the oxidative metabolism of xenobiotics.
Pathways Not Available
Reactions
Arachidonic acid + Oxygen → 14,15-epoxy-5,8,11-eicosatrienoic acid + Water details
Arachidonic acid + Oxygen → 11,12-Epoxyeicosatrienoic acid + Water details
Arachidonic acid + Oxygen → 8,9-Epoxyeicosatrienoic acid + Water details
Arachidonic acid + Oxygen → 5,6-Epoxy-8,11,14-eicosatrienoic acid + Water details
Retinoic acid → all-trans-5,6-Epoxyretinoic acid details
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 26
Locus Not Available
SNPs CYP2E1
Gene Sequence
>1488 bp
ATGGCCGCCCTGGGCATCACGGTCGCCCTGCTGGTGTGGATGGCCACCCTGCTGTTCATC
TCCATCTGGAAGCACATCTACAGCAGCTGGAAACTGCCCCCTGGCCCTTTCCCACTGCCC
ATCATCGGGAATCTTTTACAGCTGGATATTAAGAACATTCCCAAATCCTTCACCAGGCTG
GCGGAGAGGTACGGGCCGGTGTTCACCCTGTACCTGGGCTCTCAGCGTGCCGTGGTCGTG
CATGGCTACAAGCCCGTGAAGGAGGTCCTGCTTGACTACAAGAACGAGTTTTCTGGCAGA
GGAGAAAACCCTGGGTTCCAGATGCACAAGAACAATGGGATCATTTTCAACAATGGATCA
ACCTGGCGGGACACCCGACGGTTCTCGTTGACCACCCTCCGTGACTTAGGGATGGGAAAA
CAGGGCAATGAGCAGCGGATCCAGAGGGAGGCCCACTTCCTGCTGGAGGTGCTCAGGAAG
ACCCAGGGCCAGCCCTTTGACCCCACGTTTGTCGTCGGCTTTGCACCTTACAATGTCATC
TCTGACATCCTCTTCCACAAACGCTTTGACTATAAAGATCAGACGAGCCTGAGGCTGATG
AGTCTGTTCAACGAGAACTTCTACCTGCTCAGCAGCCCCTGGATCCAGCTTTATAATAAT
TTCCCAGACTACCTACAGTACCTGCCTGGAAGCCATAGAAAGCTACTGAAAAATGTGTCT
GAAGTAAAAAGTTATGCTTTAGAAAGAGTGAAGGATCACCAGAAGTCCCTGGAACCCAGC
TGCCCCCGAGGCTTCTTGGACACCATGCTGATAGAAATGGCCAAGGAAAGACACAGTGTG
GACCCTATGTACACCTTGGAAAACATCGCTGTGACTGTGGCCGACCTGCTCTTTGCGGGG
ACAGAGACCACCAGCACCACCCTGCGATACGGGCTCCTGATTCTCATGAAATACCCGGAG
GTTGAAGAGAAACTTCATGAAGAAATTGACAGGGTGATTGGGCCAAGCCGAATCCCTGCC
GTCAAGGACAGGCTGGACATGCCCTACCTGGATGCTGTGGTACATGAGATTCAGCGATTC
ATCGACCTCCTTCCCTCCAATCTGCTCCACGAAGCAACCCAGGACACAGTGTTCAGAGGA
TATGTCATCCCCAAGGGCACAGTCGTAATTCCGACGCTGGACTCTGTCTTACACGATAGG
CAAGAGTTTCCTGAACCAGAGAAGTTTAAACCAGAGCACTTTCTGAATGAAAATGGAAAG
TTCAAGTACAGTGACCATTTTAAGGCGTTTTCTGCAGGAAAGCGGGTGTGTGTTGGAGAA
GGCCTGGCTCGCATGGAACTGTTCCTGCTCTTGGCCGCCATCCTGCAGCACTTTAACTTG
AAGTCACTTGTTGACCCCAAGGATATCGACCTCAGCCCCATTGCAATTGGGTTTGGCAAG
ATCCCGCCCCGTTACAAACTCTGTCTCATTCCCCGCTCAAAAGTGTGA
Protein Properties
Number of Residues 495
Molecular Weight 56827.0
Theoretical pI 9.3
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>Cytochrome P450 2E1
MAALGITVALLVWMATLLFISIWKHIYSSWKLPPGPFPLPIIGNLLQLDIKNIPKSFTRL
AERYGPVFTLYLGSQRAVVVHGYKPVKEVLLDYKNEFSGRGENPGFQMHKNNGIIFNNGS
TWRDTRRFSLTTLRDLGMGKQGNEQRIQREAHFLLEVLRKTQGQPFDPTFVVGFAPYNVI
SDILFHKRFDYKDQTSLRLMSLFNENFYLLSSPWIQLYNNFPDYLQYLPGSHRKLLKNVS
EVKSYALERVKDHQKSLEPSCPRGFLDTMLIEMAKERHSVDPMYTLENIAVTVADLLFAG
TETTSTTLRYGLLILMKYPEVEEKLHEEIDRVIGPSRIPAVKDRLDMPYLDAVVHEIQRF
IDLLPSNLLHEATQDTVFRGYVIPKGTVVIPTLDSVLHDRQEFPEPEKFKPEHFLNENGK
FKYSDHFKAFSAGKRVCVGEGLARMELFLLLAAILQHFNLKSLVDPKDIDLSPIAIGFGK
IPPRYKLCLIPRSKV
GenBank ID Protein CAA04948.1
UniProtKB/Swiss-Prot ID O18963
UniProtKB/Swiss-Prot Entry Name CP2E1_BOVIN
PDB IDs Not Available
GenBank Gene ID AJ001715
GeneCard ID CYP2E1
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available