Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00064
Secondary Accession Numbers None
Name Thromboxane-A synthase
Synonyms Not Available
Gene Name TBXAS1
Protein Type Enzyme
Biological Properties
General Function Secondary metabolites biosynthesis, transport and catabolism
Specific Function Not Available
Pathways
  • Arachidonic Acid Metabolism
Reactions
Prostaglandin H2 → Thromboxane A2 details
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 4
Locus Not Available
SNPs TBXAS1
Gene Sequence
>1602 bp
ATGGAAGTCTTAGGGCTCTTCAGGCTGGAAGTGAGTGGCCCCATGGTGACGGTGGCCCTG
TCCGTGGTCTTCTTGGCCCTCCTGAAATGGTACTCCACATCAGCGTTTTCAAGACTAGAG
AAGTTGGGCATCAGACATCCCAAGCCTTCTCCTTTTATTGGAAACTTAGCGTTTTTCCGC
CAGGGTTTCTGGGAAAGCCACATGGAGCTCAGAAAGCAATATGGACCTCTGAGTGGGTAC
TATCTTGGTCGTCTGATGTTTATTGTTATCTCTGAGCCAGACATGATTGAGCAGGTGTTG
GTTGAGAAGTTCAGTAACTTTACCAACAGAATGGCAACGGGTTTGGAGCCCAAACCAGTG
GCCGACAGTGTCCTGTTCTTACGTGACAAAAGATGGGAAGAGGTCAGAAGTGTCCTGACT
GTGGCTTTCAGTCCTGAAAAACTGAGTGAGATGACTCCTTTAATCAGCCGGGCCTGCGAT
GTGCTTCTGGCTCACCTAGAGCGTCACGCACAGTCTGGGGAGGCTTTTGACATCCAGAGG
ACCTACTGCTGCTACACCACAGATGTGGTGGCCAGTGTTGCCTTTGGCACCGAAGTGAAC
TCCCAGGAGGCTCCTGAGCACCCCTTCGTGGAGCACTGCAGGCGCTTCTTTGCATCCTCC
ATCCCCAAACCTCTCCTGGTTTTACTCTTATCATTTCCATCCATAATGGTCCCACTGGCC
CGGATTTTGCCCAATAAGAACCGAGATGAACTGAATGGCTTTTTTAACAAACTCATTAGG
AATGTGATTGCCTTGCGGGACCAGCAAGCAGCCGAAGAGAGGAGGAGAGATTTCCTCCAA
ATGGTCCAGGATGTGCGCCATTCTGCTGCCACAGTGGGCGTGGAGAAATTTGACATCGTC
CGTCAGGTCTTTTCTGCCACCAAATGCCCAGCAAACCCTCCCCGGCGACACTCACCCAGA
CCCCTGTCCAAGCCTTTGAGTGTGGATGAGGTGGTGGGCCAGGCCTTCATCTTCCTCATC
GCTGGCTACGAGATTGTCACCAACACTCTCTCTTTCGCCACCTACCTCCTGGCCACCAAC
CCTGAGTGCCAAGAGAAGCTTCTGGAAGAGGTGGACTGTTTCAGCAAGGAACATCTGGCC
CCTGAGTACTGCAGCCTCCAGGAAGGTCTGCCCTACTTGGACATGGTGATTAAAGAGACC
TTGAGGATGTACCCACCGGCTTTCAGGTTCACGCGGGTGGCGGCACAGGACTGCGAGGTG
CTGGGCCAGCGCATCCCCGCAGGCGCTGTGCTAGAGACGGCCGTGGGCGCTCTGCACTAC
GACCCCGAGCACTGGCCGAACCCCGAGAACTTCAACCCCGAGAGGTTCACTGCCGAGGCG
CAACAACGCCGGCGGCCCTACACGTACCTGCCGTTTGGGGCGGGCCCCCGGAGCTGCCTC
GGGGTTCGGCTGGGGCTCCTGGAGCTCAAGCTGACGCTGCTCCACATCCTGCGCAAGTTC
CGGTTCGAAGCCTGTCCCGAGACGCAGGTACCACTGCAGCTAGAATCCAAATCTGCCCTA
GGTCCAAAAAATGGCGTCTACATCAGAATCGTCTCTCGCTGA
Protein Properties
Number of Residues 533
Molecular Weight 60539.0
Theoretical pI 8.06
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • 11-31
  • 76-96
  • 224-244
  • 336-356
Protein Sequence
>Thromboxane-A synthase
MEVLGLFRLEVSGPMVTVALSVVFLALLKWYSTSAFSRLEKLGIRHPKPSPFIGNLAFFR
QGFWESHMELRKQYGPLSGYYLGRLMFIVISEPDMIEQVLVEKFSNFTNRMATGLEPKPV
ADSVLFLRDKRWEEVRSVLTVAFSPEKLSEMTPLISRACDVLLAHLERHAQSGEAFDIQR
TYCCYTTDVVASVAFGTEVNSQEAPEHPFVEHCRRFFASSIPKPLLVLLLSFPSIMVPLA
RILPNKNRDELNGFFNKLIRNVIALRDQQAAEERRRDFLQMVQDVRHSAATVGVEKFDIV
RQVFSATKCPANPPRRHSPRPLSKPLSVDEVVGQAFIFLIAGYEIVTNTLSFATYLLATN
PECQEKLLEEVDCFSKEHLAPEYCSLQEGLPYLDMVIKETLRMYPPAFRFTRVAAQDCEV
LGQRIPAGAVLETAVGALHYDPEHWPNPENFNPERFTAEAQQRRRPYTYLPFGAGPRSCL
GVRLGLLELKLTLLHILRKFRFEACPETQVPLQLESKSALGPKNGVYIRIVSR
GenBank ID Protein AAI12648.1
UniProtKB/Swiss-Prot ID Q2KIG5
UniProtKB/Swiss-Prot Entry Name THAS_BOVIN
PDB IDs Not Available
GenBank Gene ID BC112647
GeneCard ID TBXAS1
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available