You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Showing Protein 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1 (BMDBP00074)
Identification | |
---|---|
BMDB Protein ID | BMDBP00074 |
Secondary Accession Numbers | None |
Name | 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1 |
Synonyms | Not Available |
Gene Name | PLCZ1 |
Protein Type | Enzyme |
Biological Properties | |
General Function | Involved in calcium ion binding |
Specific Function | The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes. In vitro, hydrolyzes PtdIns(4,5)P2 in a Ca(2+)-dependent manner. Triggers intracellular Ca(2+) oscillations in oocytes solely during M phase and is involved in inducing oocyte activation and initiating embryonic development up to the blastocyst stage. Is therefore a strong candidate for the egg-activating soluble sperm factor that is transferred from the sperm into the egg cytoplasm following gamete membrane fusion. May exert an inhibitory effect on phospholipase-C-coupled processes that depend on calcium ions and protein kinase C, including CFTR trafficking and function. |
Pathways | Not Available |
Reactions | Not Available |
GO Classification | Not Available |
Cellular Location | Not Available |
Gene Properties | |
Chromosome Location | 5 |
Locus | Not Available |
SNPs | PLCZ1 |
Gene Sequence | Not Available |
Protein Properties | |
Number of Residues | 634 |
Molecular Weight | 73732.0 |
Theoretical pI | 7.01 |
Pfam Domain Function | Not Available |
Signals |
|
Transmembrane Regions | Not Available |
Protein Sequence |
>1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase zeta-1 MENKWFLLMVRDDFKGGKITLEKALKLLEKLDIQCNTIHVKYIFKDNDRLKQGRITIEEF RTIYRIITYREEIIEIFNTYSENRKILLEKNLVEFLMREQYTLDFNKSIASEIIQKYEPI EEVKQAHQMSFEGFRRYMDSSECLLFDNKCDHVYQDMTHPLTDYFISSSHNTYLISDQLW GPSDLWGYISALVKGCRCLEIDCWDGSQNEPVVYHGYTFTSKLLFKTVIQAINKYAFLAS EYPVVLSLENHCSPSQQEVMADSLLATFGDALLSYTLDNFSDRLPSPEALKFKILVRNKK IGTLHETLERKGSDMHGKVEEFEEEEEIEQEEDGSGAKEPEPVGDFQDDLAKEEQLKRVV GIPLFRKKKIKISMALSDLVIYTKVEKFKSFHHSHLYQQFNESNSIGESQARKLTKLAAR EFILHTRRFITRVYPKALRADSSNFNPQEFWNVGCQMVALNFQTPGVPMDLQNGKFLDNG CSGYVLKPRFLRDKKTKFNPHKVQIDSNPLTLTIRLISGIQLPPSYQNKADTLVIVEIFG VPNDQMKQQSRVIKKNAFNPRWNETFTFVIQVPELALIRFVAENQGLIAGNEFLGQYTLP VLCMNRGYRRVPLFSKMGESLEPASLFIYVWYIR |
External Links | |
GenBank ID Protein | AAV54518.1 |
UniProtKB/Swiss-Prot ID | Q1RML2 |
UniProtKB/Swiss-Prot Entry Name | PLCZ1_BOVIN |
PDB IDs | Not Available |
GenBank Gene ID | AY646356 |
GeneCard ID | PLCZ1 |
GenAtlas ID | Not Available |
HGNC ID | Not Available |
References | |
General References | Not Available |