You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00086
Secondary Accession Numbers None
Name Serine--tRNA ligase, cytoplasmic
Synonyms Not Available
Gene Name SARS1
Protein Type Enzyme
Biological Properties
General Function Translation, ribosomal structure and biogenesis
Specific Function Catalyzes the attachment of serine to tRNA(Ser) in a two-step reaction: serine is first activated by ATP to form Ser-AMP and then transferred to the acceptor end of tRNA(Ser). Is probably also able to aminoacylate tRNA(Sec) with serine, to form the misacylated tRNA L-seryl-tRNA(Sec), which will be further converted into selenocysteinyl-tRNA(Sec). In the nucleus, binds to the VEGFA core promoter and prevents MYC binding and transcriptional activation by MYC. Recruits SIRT2 to the VEGFA promoter, promoting deacetylation of histone H4 at 'Lys-16' (H4K16). Thereby, inhibits the production of VEGFA and sprouting angiogenesis mediated by VEGFA.
Pathways
  • Aminoacyl-tRNA biosynthesis
  • Glycine and Serine Metabolism
  • L-seryl-tRNA(Sec) from L-serine and tRNA(Sec): step 1/1
  • Protein Synthesis: Serine
  • Selenocysteinyl-tRNA(Sec) biosynthesis
Reactions
L-Serine + Adenosine triphosphate + L-Seryl-tRNA → Adenosine monophosphate + L-Seryl-tRNA(Ser) + Pyrophosphate details
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 3
Locus Not Available
SNPs SARS1
Gene Sequence
>1545 bp
ATGGTGCTGGATCTGGATTTGTTTCGGGTGGATAAAGGGGGGGACCCAGCACTCATCCGA
GAGTCGCAGGAGAAGCGCTTCAAGGACCCGGGACTGGTGGACCAGCTGGTGAAGGCAGAC
AGCGAGTGGCGACGATGCAGATTTCGGGCAGACAACTTGAACAAGCTGAAGAACCTATGC
AGCAAGACAATTGGAGAGAAAATGAAGAAAAAAGAGCCAGTGGGAAATGATGAGTCCATT
CCAGAAGATGTATTAAATCTCGATGACCTCACTGCAGACACTTTAACTAACCTAAAAGTC
TCACAGATCAAAAAAGTCCGCCTCCTCGTCGACGAAGCCATCCTGAAGTGTGACGCCGAG
CGGATAAAACTGGAAGCTGAGCGGTTTGAGAGCCTTCGGGAGATCGGGAACCTCCTGCAC
CCGTCGGTGCCCATCAGCGATGACGAGGATGCCGACAACAAAGTAGAGAGGATTTGGGGT
GATTGTACAGTCAGGAAGAAGTACTCTCACGTGGACCTGGTGGTGATGGTAGATGGCTTT
GAAGGCGAAAAGGGGGCCGTGGTGGCTGGGAGTCGAGGGTACTTCCTGAAGGGGGTCCTG
GTGTTCCTGGAACAAGCACTCATCCAGTTTGCCCTTCGGACCTTGGCAAGTCGGGGCTAC
ACTCCCATTTATACCCCCTTCTTCATGAGGAAGGAGGTCATGCAGGAAGTGGCACAGCTC
AGCCAGTTTGATGAAGAACTTTATAAGGTGATTGGCAAAGGCAGTGAAAAGTCTGATGAT
AACTCCTATGAGGAGAAATATCTGATTGCTACCTCTGAACAACCCATTGCTGCTCTTCAC
CGGGACGAGTGGCTTCGGCCAGAGGACTTGCCAATCAAGTATGCCGGCCTGTCCACCTGC
TTTCGCCAGGAGGTGGGCTCCCATGGGCGTGACACCCGTGGCATCTTTAGAGTCCATCAG
TTTGAGAAGATAGAGCAGTTTGTNTACTCCTCGCCACACGACAACAAGTCCTGGGAGATG
TTTGAGGAGATGATTGCCACCGCGGAGGAGTTCTACCAGTCTCTGGGGATCCCTTACCAC
ATCGTGAATATCGTCTCAGGTTCTTTGAATCATGCTGCCAGTAAGAAGCTTGACCTGGAG
GCCTGGTTTCCAGGCTCGGGGGCCTTCCGTGAGTTAGTCTCCTGTTCTAACTGCACAGAC
TATCAGGCTCGCCGGCTCCGAATCCGATATGGGCAGACCAAGAAGATGATGGACAAGGTG
GAGTTTGTCCACATGCTCAATGCCACCATGTGTGCCACAACCCGCACCATCTGTGCCATC
CTGGAGAACTACCAGACAGAGAAGGGCATCCTCGTGCCTGAGAAATTGAAGGAATTCATG
CCGCCAGGTCTCCAAGAACTGATCCCCTTTGTGAAGGCTGCGCCCATTGACCAGGAGCCC
TCCAAGAAGCAGAAGAAGCAGCATGAGGGCAGCAAGAAGAAAGGGGCAGCGAGAGATGTT
GCCCTGGAGAGCCAGCTGCAGAACATGGAGGTCACCGATGCCTGA
Protein Properties
Number of Residues 514
Molecular Weight 58605.0
Theoretical pI 6.07
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>Seryl-tRNA synthetase, cytoplasmic
MVLDLDLFRVDKGGDPALIRESQEKRFKDPGLVDQLVKADSEWRRCRFRADNLNKLKNLC
SKTIGEKMKKKEPVGNDESIPEDVLNLDDLTADTLTNLKVSQIKKVRLLVDEAILKCDAE
RIKLEAERFESLREIGNLLHPSVPISDDEDADNKVERIWGDCTVRKKYSHVDLVVMVDGF
EGEKGAVVAGSRGYFLKGVLVFLEQALIQFALRTLASRGYTPIYTPFFMRKEVMQEVAQL
SQFDEELYKVIGKGSEKSDDNSYEEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTC
FRQEVGSHGRDTRGIFRVHQFEKIEQFVYSSPHDNKSWEMFEEMIATAEEFYQSLGIPYH
IVNIVSGSLNHAASKKLDLEAWFPGSGAFRELVSCSNCTDYQARRLRIRYGQTKKMMDKV
EFVHMLNATMCATTRTICAILENYQTEKGILVPEKLKEFMPPGLQELIPFVKAAPIDQEP
SKKQKKQHEGSKKKGAARDVALESQLQNMEVTDA
GenBank ID Protein AAG03084.1
UniProtKB/Swiss-Prot ID Q9GMB8
UniProtKB/Swiss-Prot Entry Name SYSC_BOVIN
PDB IDs Not Available
GenBank Gene ID AF297553
GeneCard ID SARS1
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available