You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00089
Secondary Accession Numbers None
Name Inositol-tetrakisphosphate 1-kinase
Synonyms Not Available
Gene Name ITPK1
Protein Type Enzyme
Biological Properties
General Function Involved in ATP binding
Specific Function Kinase that can phosphorylate various inositol polyphosphate such as Ins(3,4,5,6)P4 or Ins(1,3,4)P3. Phosphorylates Ins(3,4,5,6)P4 at position 1 to form Ins(1,3,4,5,6)P5. This reaction is thought to have regulatory importance, since Ins(3,4,5,6)P4 is an inhibitor of plasma membrane Ca(2+)-activated Cl(-) channels, while Ins(1,3,4,5,6)P5 is not. Also acts as an inositol polyphosphate phosphatase that dephosphorylate Ins(1,3,4,5)P4 and Ins(1,3,4,6)P4 to Ins(1,3,4)P3, and Ins(1,3,4,5,6)P5 to Ins(3,4,5,6)P4. May also act as an isomerase that interconverts the inositol tetrakisphosphate isomers Ins(1,3,4,5)P4 and Ins(1,3,4,6)P4 in the presence of ADP and magnesium. Probably acts as the rate-limiting enzyme of the InsP6 pathway. Modifies TNF-alpha-induced apoptosis by interfering with the activation of TNFRSF1A-associated death domain (By similarity). Also phosphorylates Ins(1,3,4)P3 on O-5 and O-6 to form Ins(1,3,4,6)P4, an essential molecule in the hexakisphosphate (InsP6) pathway. Plays an important role in MLKL-mediated necroptosis. Produces highly phosphorylated inositol phosphates such as inositolhexakisphosphate (InsP6) which bind to MLKL mediating the release of an N-terminal auto-inhibitory region leading to its activation. Essential for activated phospho-MLKL to oligomerize and localize to the cell membrane during necroptosis (By similarity).
Pathways
  • Inositol Metabolism
  • Inositol Phosphate Metabolism
Reactions
Inositol 1,3,4,5,6-pentakisphosphate + ADP → D-Myo-inositol 3,4,5,6-tetrakisphosphate + Adenosine triphosphate details
Adenosine triphosphate + Inositol 1,3,4-trisphosphate → ADP + 1D-Myo-inositol 1,3,4,6-tetrakisphosphate details
Inositol 1,3,4-trisphosphate + Adenosine triphosphate → Inositol 1,3,4,5-tetraphosphate + ADP details
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 21
Locus Not Available
SNPs ITPK1
Gene Sequence Not Available
Protein Properties
Number of Residues 419
Molecular Weight 45842.0
Theoretical pI 6.09
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>Inositol-tetrakisphosphate 1-kinase
MQTFLKGKRVGYWLSEKKIKKLNFQAFAELCRKRGIEVVQLNLSRPIEEQGPLDVIIHKL
TDVILEADQNDSQALELVHRFQEYIDAHPETIVLDPLPAIRTLLDRSKSYELIRKIEAYM
KDDRICSPPFMELTSLCGDDTMRLLEENGLAFPFICKTRVAHGTNSHEMAIVFNQEGLSA
IQPPCVVQNFINHNAVLYKVFVVGESYTVVQRPSLKNFSAGTSDRESIFFNSHNVSKPES
SSVLTALDKIEGVFERPSDEVIRELSRALRQALGVSLFGIDIIINNQTGQHAVIDINAFP
GYEGVSEFFTDLLNHIASVLQGQSSGVAGAGDVAPLKHSRLLAEQAGGLAAERTCSASPG
CCSSMMGQEPPWTPEADMGGVGAGSTAKLPHQRLGCTAGVSPSFQQHCVASLATKASSQ
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P0C0T1
UniProtKB/Swiss-Prot Entry Name ITPK1_BOVIN
PDB IDs Not Available
GenBank Gene ID DT820636
GeneCard ID ITPK1
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available