Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00092
Secondary Accession Numbers None
Name Glycerol-3-phosphate dehydrogenase, mitochondrial
Synonyms Not Available
Gene Name GPD2
Protein Type Enzyme
Biological Properties
General Function Energy production and conversion
Specific Function Not Available
Pathways
  • Glycerol degradation via glycerol kinase pathway
  • Glycerol Phosphate Shuttle
  • Glycerolipid Metabolism
  • Glycerone phosphate from sn-glycerol 3-phosphate (aerobic route): step 1/1
  • Mitochondrial Electron Transport Chain
  • Phospholipid Biosynthesis
  • Polyol metabolism
Reactions
Glycerol 3-phosphate + Quinone → Dihydroxyacetone phosphate + Hydroquinone details
Dihydroxyacetone phosphate + Quinone → Glycerol 3-phosphate + Hydroquinone details
Coenzyme Q10 + Glycerol 3-phosphate → Ubiquinol + Dihydroxyacetone phosphate details
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 2
Locus Not Available
SNPs GPD2
Gene Sequence
>2184 bp
ATGGCATTTCAAAAGGCGGTGAAAGGGACTATTCTTGTTGGAGGAGGTGCTCTTGCCACT
GTTCTAGGCCTCTCTCATTTTGCTCATTACAAAAGGAAGCAAGTGAACCTGGCCTTTGTT
GAAGCAGCAGACTGCATTTCAGAACCTGTTAACAGGGAGCCTCCTTCCAGAGAAGCTCAG
ATACTGACTTTGAAAAACACATCTGAGTTCGATGTACTTGTCATCGGAGGAGGAGCGACA
GGAAGTGGCTGTGCCCTGGATGCGGTCACCAGAGGACTAAAAACAGCCCTTGTAGAAAGA
GATGATTTCTCATCGGGGACCAGCAGCAGAAGCACTAAATTGATCCATGGTGGTGTGAGA
TATCTTCAGAAGGCTATCATGAAGTTGGATATTGAGCAGTACAGGATGGTAAAAGAAGCC
CTTCATGAGCGTGCCAACCTGCTGGAAATTGCTCCCCATTTATCAGCTCCATTGCCTATT
ATGCTTCCAATTTACAAATGGTGGCAGTTACCATACTACTGGGTAGGAATCAAGCTATAT
GATCTGGTTGCTGGAAGTAATTGCCTGAAAAGCAGTTATGTCCTCAGCAAATCAAGAGCC
CTTGAGCATTTCCCAATGCTCCAGAAGGACAAACTGGTGGGAGCAATTGTCTACTATGAT
GGACAACACAACGACGCACGGATGAACCTTGCCATTGCTCTCACCGCTGCCAGGTATGGG
GCTGCCACGGCCAATTACATGGAGGTCATGAGTTTGCTCAAGAAGACAGACCCCCAGACA
GGGAAAGAGCGTGTGAGCGGTGCACGGTGTAAGGATGTGCTGACAGGGGAGGAATTTGAT
GTGAGAGCCAAGTGTGTTATCAATGCCACGGGACCTTTCACAGACACCGTGCGCAAAATG
GATGATAAGGACACCACAGCTATCTGCCAGCCGAGTGCTGGCGTCCACATCGTGATGCCT
GGTTACTACAGCCCAGAGAGCATGGGACTTCTTGACCCAGCGACCAGTGATGGGAGAGTT
ATTTTCTTCTTGCCCTGGCAAAAGATGACTATAGCTGGCACTACCGACACTCCAACTGAT
GTTACACACCATCCCATTCCTTCCGAAGAAGATATCAACTTCATTTTGAATGAAGTGCGT
AACTACTTGAGTTGTGATGTTGAAGTGAGAAGAGGGGATGTCCTGGCTGCGTGGAGCGGT
ATTCGCCCCCTTGTGACAGATCCCAAGTCTGCAGACACGAAGTCCATCTCCCGAAACCAT
GTCGTGGACATCAGCGAGAGTGGCCTTATCACCATAGCAGGTGGAAAGTGGACAACCTAT
CGATCTATGGCAGAAGATACCATAAATGCCGCAGTCAAGGCACACAATTTGAAAGCAGGA
CCAAGTAGAACAGTTGGGCTTTTCCTTCAGGGGGGCAAAGACTGGAGCCCCACACTCTAC
ATCAGGCTCGTCCAGGACTATGGACTTGAAAGTGAGGTGGCCCAGCATCTTGCCGCCACC
TATGGTGATAAGGCTTTTGAGGTGGCCAAGATGGCAAGTGTGACGGGAAAGCGGTGGCCC
ATTGTTGGGGTGCGTCTTGTGTCGGAATTTCCATACATTGAAGCAGAGGTGAAATACGGG
ATTAAGGAGTATGCTTGTACCGCTGTGGATATGATTTCACGTCGTACTCGCCTGGCCTTC
CTAAATGTGCAGGCGGCAGAGGAGGCCCTACCTAGGATTGTTGAATTGATGGGCCGAGAA
TTGAATTGGGATGATTCTAAAAAAGAGGAAGAACTTGAAACAGCCAGGAAGTTTCTATAT
TATGAAATGGGCTATAAATCTCGATCAGAACAGTTAACAGATCGCTCTGAAATTAGCCTA
CTGCCTTCAGACATTGACAGGTACAAGAAGAGATTTCATAAATTCGATGCAGACCAGAAA
GGCTTTATTACCATTGTTGATGTTCAACGTGTATTAGAGAGTATCGGCGTCCAAATGGAT
GAAAATACGCTACATGAAATTTTGAATGAAGTAGATTTGAATAAAAATGGACAGGTTGAA
CTCAATGAATTTTTGCAGCTGATGAGTGCTATTCAAAAAGGAAGGGTGTCTGGAAGCCGG
CTCGCTATACTCATGAAAACTGCCGAAGAAAATCTCGATAGAAGAGTTCCCATCCCTGTG
GACCGAAGTTGTGGAGGATTGTGA
Protein Properties
Number of Residues 727
Molecular Weight 80763.0
Theoretical pI 7.05
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>Glycerol-3-phosphate dehydrogenase, mitochondrial
MAFQKAVKGTILVGGGALATVLGLSHFAHYKRKQVNLAFVEAADCISEPVNREPPSREAQ
ILTLKNTSEFDVLVIGGGATGSGCALDAVTRGLKTALVERDDFSSGTSSRSTKLIHGGVR
YLQKAIMKLDIEQYRMVKEALHERANLLEIAPHLSAPLPIMLPIYKWWQLPYYWVGIKLY
DLVAGSNCLKSSYVLSKSRALEHFPMLQKDKLVGAIVYYDGQHNDARMNLAIALTAARYG
AATANYMEVMSLLKKTDPQTGKERVSGARCKDVLTGEEFDVRAKCVINATGPFTDTVRKM
DDKDTTAICQPSAGVHIVMPGYYSPESMGLLDPATSDGRVIFFLPWQKMTIAGTTDTPTD
VTHHPIPSEEDINFILNEVRNYLSCDVEVRRGDVLAAWSGIRPLVTDPKSADTKSISRNH
VVDISESGLITIAGGKWTTYRSMAEDTINAAVKAHNLKAGPSRTVGLFLQGGKDWSPTLY
IRLVQDYGLESEVAQHLAATYGDKAFEVAKMASVTGKRWPIVGVRLVSEFPYIEAEVKYG
IKEYACTAVDMISRRTRLAFLNVQAAEEALPRIVELMGRELNWDDSKKEEELETARKFLY
YEMGYKSRSEQLTDRSEISLLPSDIDRYKKRFHKFDADQKGFITIVDVQRVLESIGVQMD
ENTLHEILNEVDLNKNGQVELNEFLQLMSAIQKGRVSGSRLAILMKTAEENLDRRVPIPV
DRSCGGL
GenBank ID Protein AAI48086.1
UniProtKB/Swiss-Prot ID A6QLU1
UniProtKB/Swiss-Prot Entry Name GPDM_BOVIN
PDB IDs Not Available
GenBank Gene ID BC148085
GeneCard ID GPD2
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available