Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00095
Secondary Accession Numbers
  • BMDBP03044
Name Membrane primary amine oxidase
Synonyms Not Available
Gene Name AOC3
Protein Type Enzyme
Biological Properties
General Function Secondary metabolites biosynthesis, transport and catabolism
Specific Function Cell adhesion protein that participates in lymphocyte recirculation by mediating the binding of lymphocytes to peripheral lymph node vascular endothelial cells in an L-selectin-independent fashion. Has a monoamine oxidase activity (By similarity).
Pathways Not Available
Reactions
1,3-Diaminopropane + Oxygen + Water → 3-Aminopropionaldehyde + Ammonia + Hydrogen peroxide details
Histamine + Water + Oxygen → Imidazole-4-acetaldehyde + Ammonia + Hydrogen peroxide details
Tyramine + Water + Oxygen → Homovanillin + Hydrogen peroxide + Ammonia details
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 19
Locus Not Available
SNPs AOC3
Gene Sequence
>2292 bp
ATGAACCAGAAGACCACCCTGGTGCTCCTTGCTCTGGCTGTCATCACCATCTTTGCCTTG
GTGTGTGTCTTAATAGCTGGCAGGGGAGGAGATGGGGGTGAAGCCAGCCAACCTCACTAC
TGCCCCTCCGGAACCCCCAGTGTCCAGCCCTGGACACACCCTGGCCAGAACCAGCTGTTT
GCAGACCTGAGCCGAGAAGAGCTGACAGCTGTGATGAGCTTCCTGACCCAGAAGCTGGGG
CCAGACCTGGTGGATGCAGCCCAGGCCCGACCCTCTGACAACTGCATCTTCTCGGTAGAG
CTGCAGCTGCCCCCCAAGGCTGCAGCCCTGGCCCACCTGGACAGGAGGAGCCCCCCACCT
GCCCGGGAGGCACTGGCCATCGTCTTCTTTGGTGGACAACCCCAGCCCAATGTGACTGAG
CTGGTGGTGGGGCCGCTGCCCCAGCCCTCCTACATGCGGGATGTGACCGTGGAGCGTCAT
GGGGGCCCCCTGCCCTATTACCGACGCCCCGTGCTTCTCCGAGAGTACCTGGACATAGAC
CAGATGATCTTCAACAGAGAGCTGCCCCAGGCTGCTGGTGTCCTGCACCACTGCTGCTCC
TACAAACAAGGAGGAGGGAACCTGGTGACCATGACCACAGCCCCCCGCGGTTTGCAATCA
GGTGACCGGGCCACCTGGTTTGGCCTCTACTACAACATCTCAGGGGCTGGGTACTATCTG
CACCCTGTGGGGTTAGAGCTGCTGGTAGATCACAAGGCTCTGGACCCTGCCCAGTGGACC
ATCCAGAAGGTGTTCTTTCAAGGCCGCTACTATGAAAGTCTGGCCCAGCTGGAGGAGCAG
TTTGAGGCTGGCCGGGTGAATGTGGTGGTGATCCCAAACAATGGCACAGGTGGGTCCTGG
TCCCTGAAGTCCCAGGTGCCCCCGGGTCCAACTCCACCTCTGCAGTTCCATCCTCAGGGC
ACCCGCTTCAGTGTCCAGGGCAGTCGAGTGACCTCCTCATTGTGGACTTTCTCCTTTGGC
CTCGGAGCTTTCAGTGGTCCTAGGATCTTTGACATTCGATTCCAAGGAGAACGACTGGCT
TATGAGATCAGCCTGCAAGAGGCCGTGGCTATTTATGGTGGGAATACCCCAGCAGCAATG
CTCACTCGCTATATGGATGGCTGCTTTGGCATGGGCAAGTTCGCCACGCCCCTGACCCGA
GGGGTGGACTGCCCCTATCTGGCCACCTATGTGGACTGGCACTTCCTTCTGGAGTCTCAA
GCCCCCAGGACCCTACATGATGCCTTTTGTGTGTTTGAGCAGAACAAGGGCCTGCCCCTG
AGGCGACACCACTCAGATTTTATTTCCCAGTATTTTGGGGGCGTTGTGGAGACAGTGCTG
GTCTTCAGATCTGTGTCAACCTTGCTCAACTATGACTATGTGTGGGATATGGTCTTTCAC
CCCAATGGGGCCATAGAAGTCAAATTCCATGCCACGGGCTATATCAGCTCAGCGTTCTTC
TTTGGTACTGCCCAAAAATACGGAAACCAGGTTCGGGAGAATACACTGGGCACCGTCCAC
ACCCACAGTGCCCACTACAAGGTGGATCTGGATGTGGGAGGACTGGAGAACTGGGTCTGG
GCTGAGGACATGGCTTTTGTCCCCACAACGGTACCCTGGAGCCCTGAGCACCAGATACAG
AGGCTGCAGGTGACCCGGAAGCAGCTGGAGACTGAGGAGCAGGCCGCCTTCCCCCTGGGA
GGGGCCTCCCCTCGCTACCTGTACCTGGCCAGCAAGCAGAGCAACAAGTGGGGGCACCCT
CGCGGCTATCGCATCCAGACGGTCAGCTTTGCTGGGAGGCCGCTGCCCCAGAACAGCTCC
ACAGAGAGAGCCATCAGCTGGGGGAGGTACCAGCTGGCCGTGACCCAGAGGAAGGAGACA
GAGCCCAGCAGCTCCAGCGTCTTCAATCAGAATGACCCCTGGACTCCCACTGTGGACTTT
GCTGACTTCATCAACAATGAGACCATTGCTGGAAAGGACTTGGTGGCCTGGGTGACAGCC
GGTTTCCTGCACATCCCTCATGCAGAGGACATTCCCAACACAGTGACAGTGGGGAACGGT
GTGGGCTTCTTTCTGCGACCCTACAACTTCTTTGATGAGGACCCCTCCATCAATTCTGCT
GACTCAATCTACTTCCAAAAACACCAGGATGCTGGGTCCTGTGAGGTCAACTCCCTGGCT
TGTCTGCCCAAGGATCCTGCCTGTGCCCCTGATCTCCCTGCCTTCTCCCACGGGGGCTTC
TTCACCAATTAG
Protein Properties
Number of Residues 763
Molecular Weight 84500.0
Theoretical pI 6.51
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • 7-27
Protein Sequence
>Membrane primary amine oxidase
MNQKTTLVLLALAVITIFALVCVLIAGRGGDGGEASQPHYCPSGTPSVQPWTHPGQNQLF
ADLSREELTAVMSFLTQKLGPDLVDAAQARPSDNCIFSVELQLPPKAAALAHLDRRSPPP
AREALAIVFFGGQPQPNVTELVVGPLPQPSYMRDVTVERHGGPLPYYRRPVLLREYLDID
QMIFNRELPQAAGVLHHCCSYKQGGGNLVTMTTAPRGLQSGDRATWFGLYYNISGAGYYL
HPVGLELLVDHKALDPAQWTIQKVFFQGRYYESLAQLEEQFEAGRVNVVVIPNNGTGGSW
SLKSQVPPGPTPPLQFHPQGTRFSVQGSRVTSSLWTFSFGLGAFSGPRIFDIRFQGERLA
YEISLQEAVAIYGGNTPAAMLTRYMDGCFGMGKFATPLTRGVDCPYLATYVDWHFLLESQ
APRTLHDAFCVFEQNKGLPLRRHHSDFISQYFGGVVETVLVFRSVSTLLNYDYVWDMVFH
PNGAIEVKFHATGYISSAFFFGTAQKYGNQVRENTLGTVHTHSAHYKVDLDVGGLENWVW
AEDMAFVPTTVPWSPEHQIQRLQVTRKQLETEEQAAFPLGGASPRYLYLASKQSNKWGHP
RGYRIQTVSFAGRPLPQNSSTERAISWGRYQLAVTQRKETEPSSSSVFNQNDPWTPTVDF
ADFINNETIAGKDLVAWVTAGFLHIPHAEDIPNTVTVGNGVGFFLRPYNFFDEDPSINSA
DSIYFQKHQDAGSCEVNSLACLPKDPACAPDLPAFSHGGFFTN
GenBank ID Protein BAA88896.1
UniProtKB/Swiss-Prot ID Q9TTK6
UniProtKB/Swiss-Prot Entry Name AOC3_BOVIN
PDB IDs Not Available
GenBank Gene ID AB019242
GeneCard ID AOC3
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available