Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00109
Secondary Accession Numbers None
Name N-acetylneuraminate lyase
Synonyms Not Available
Gene Name NPL
Protein Type Enzyme
Biological Properties
General Function Amino acid transport and metabolism
Specific Function Catalyzes the cleavage of N-acetylneuraminic acid (sialic acid) to form pyruvate and N-acetylmannosamine via a Schiff base intermediate. It prevents sialic acids from being recycled and returning to the cell surface. Involved in the N-glycolylneuraminic acid (Neu5Gc) degradation pathway (By similarity).
Pathways
  • Amino Sugar Metabolism
  • Amino-sugar metabolism
  • N-acetylneuraminate degradation
Reactions
N-Acetylneuraminic acid → N-Acetyl-D-mannosamine + Pyruvic acid details
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 16
Locus Not Available
SNPs NPL
Gene Sequence
>963 bp
ATGGCCTCCCCAAAGAAGAAGCTCCAAGGTCTTGTTGCTGCGACCATCACGCCGATGACT
GAGCATGGAGAAATCAACTTTTCAGTCATTGGTCGGTATGTGGACTATCTTGTAGAGGAA
CAGGGAGTGAAGAATGTCTTTGTGAACGGCACGACGGGAGAAGGCCTGTCCCTGAGCATC
TCGGAGCGCTGCCAGGTCGCAGAGGAGTGGGTGACAAAGGGGAAGAACAAGTTGGATCAG
ATAGTAATTCATGTGGGAGCCTTGAGCTTGAAGGAGTCACAAGAACTGGCCCAACATGCA
GCAGAAATAGGAGCCGACGGCATCGCTGTCATCGCACCTTTCTTTCTCAAGCCATGGAAC
AAAGATGTCCTAATTAATTTCCTAAAAGAAGTGGCTGCTGCTGCCCCTGCATTGCCGTTT
TACTACTATCACATCCCTGCCTTGACCGGGGTGAAGATTCGTGCTGAGGAACTGTTGGAT
GGGATTCAGGATAAGATCCCCAGCTTCCAAGGGCTGAAATTCAGTGACACGGATCTCTTA
GACTTCGGGCAGTGTGTGGATCAGAATCGCCAGCGACAGTTTGCTTTCCTTTTTGGGGTG
GATGAGCAACTGTTAAGTGCTCTGGTGATGGGAGCAACTGGAGCGGTGGGCAGTACCTAT
AACTACCTGGGAAAAAAGACAAAGCAGATGTTGGAGGCTTTTGAACGAAAGGACTTCTCT
TCAGCTCTGAACCATCAGTTTTGTATTCAGAGATTTATCAACTTTGTGGTCAAACTAGGT
TTTGGAGTGTCGCAGACCAAAGCCATCATGACCCTTGTCTCCGGGATTCCAATGGGCCCA
CCCCGTCTTCCGCTACAGAAAGCCTCCAGGGAGTTTACTGATAATGCAGAAGCTAAACTG
AAAAGCCTAGATTTCCTTTCTTGCACTGATTTAAAGGATGGAAATATGGAAGCTTGTAGC
TAG
Protein Properties
Number of Residues 320
Molecular Weight 35166.0
Theoretical pI 6.37
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>N-acetylneuraminate lyase
MASPKKKLQGLVAATITPMTEHGEINFSVIGRYVDYLVEEQGVKNVFVNGTTGEGLSLSI
SERCQVAEEWVTKGKNKLDQIVIHVGALSLKESQELAQHAAEIGADGIAVIAPFFLKPWN
KDVLINFLKEVAAAAPALPFYYYHIPALTGVKIRAEELLDGIQDKIPSFQGLKFSDTDLL
DFGQCVDQNRQRQFAFLFGVDEQLLSALVMGATGAVGSTYNYLGKKTKQMLEAFERKDFS
SALNHQFCIQRFINFVVKLGFGVSQTKAIMTLVSGIPMGPPRLPLQKASREFTDNAEAKL
KSLDFLSCTDLKDGNMEACS
GenBank ID Protein AAI13333.1
UniProtKB/Swiss-Prot ID Q29RY9
UniProtKB/Swiss-Prot Entry Name NPL_BOVIN
PDB IDs Not Available
GenBank Gene ID BC113332
GeneCard ID NPL
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available