Showing Protein Heparanase (BMDBP00115)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP00115 |
| Secondary Accession Numbers | None |
| Name | Heparanase |
| Synonyms | Not Available |
| Gene Name | HPSE |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Involved in calcium ion binding |
| Specific Function | Endoglycosidase that cleaves heparan sulfate proteoglycans (HSPGs) into heparan sulfate side chains and core proteoglycans. Participates in extracellular matrix (ECM) degradation and remodeling. Selectively cleaves the linkage between a glucuronic acid unit and an N-sulfo glucosamine unit carrying either a 3-O-sulfo or a 6-O-sulfo group. Can also cleave the linkage between a glucuronic acid unit and an N-sulfo glucosamine unit carrying a 2-O-sulfo group, but not linkages between a glucuronic acid unit and a 2-O-sulfated iduronic acid moiety. Essentially inactive at neutral pH but becomes active under acidic conditions such as during tumor invasion and in inflammatory processes. Facilitates cell migration associated with metastasis, wound healing and inflammation. Enhances shedding of syndecans. Acts as procoagulant by enhancing the generation of activated factor X/F10 in the presence of tissue factor/TF and activated factor VII/F7. Independent of its enzymatic activity, increases cell adhesion to the extracellular matrix (ECM). Enhances AKT1/PKB phosphorylation, possibly via interaction with a lipid raft-resident receptor. Plays a role in the regulation of osteogenesis. Enhances angiogenesis through up-regulation of SRC-mediated activation of VEGF. Implicated in hair follicle inner root sheath differentiation and hair homeostasis (By similarity). |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 6 |
| Locus | Not Available |
| SNPs | HPSE |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 545 |
| Molecular Weight | 61077.0 |
| Theoretical pI | 9.61 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions | Not Available |
| Protein Sequence |
>Heparanase MLACRKPGLRPPLLLLLPLLGPLGPCSPGTPAAAAPADDAAELEFFTERPLHLVSPAFLS FTIDANLATDPRFFTFLGSSKLRTLARGLAPAYLRFGGNKGDFLIFDPKKEPAFEERSYW LSQSNQDICKSGSIPSDVEEKLRLEWPFQEQVLLREQYQKKFTNSTYSRSSVDMLYTFAS CSGLNLIFGVNALLRTTDMHWDSSNAQLLLDYCSSKNYNISWELGNEPNSFQRKAGIFIN GRQLGEDFIEFRKLLGKSAFKNAKLYGPDIGQPRRNTVKMLKSFLKAGGEVIDSVTWHHY YVNGRIATKEDFLNPDILDTFISSVQKTLRIVEKIRPLKKVWLGETSSAFGGGAPFLSNT FAAGFMWLDKLGLSARMGIEVVMRQVLFGAGNYHLVDGNFEPLPDYWLSLLFKKLVGNKV LMASVKGPDRSKFRVYLHCTNTKHPRYKEGDLTLYALNLHNVTKHLELPHHLFNKQVDKY LIKPSGTDGLLSKSVQLNGQILKMVDEQTLPALTEKPLHPGSSLGMPPFSYGFFVIRNAK VAACI |
| External Links | |
| GenBank ID Protein | AAF87301.2 |
| UniProtKB/Swiss-Prot ID | Q9MYY0 |
| UniProtKB/Swiss-Prot Entry Name | HPSE_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | AF281160 |
| GeneCard ID | HPSE |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |