You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00118
Secondary Accession Numbers
  • BMDBP03054
Name Monofunctional C1-tetrahydrofolate synthase, mitochondrial
Synonyms Not Available
Gene Name MTHFD1L
Protein Type Enzyme
Biological Properties
General Function Nucleotide transport and metabolism
Specific Function May provide the missing metabolic reaction required to link the mitochondria and the cytoplasm in the mammalian model of one-carbon folate metabolism in embryonic an transformed cells complementing thus the enzymatic activities of MTHFD2.
Pathways
  • One-carbon metabolism
  • Tetrahydrofolate interconversion
Reactions
5,10-Methenyltetrahydrofolic acid + NADPH → 5,10-Methylene-THF + NADP details
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 9
Locus Not Available
SNPs MTHFD1L
Gene Sequence
>2928 bp
ATGAGCGCGCGCCTGCCGTTCGTCCTGCGCCGGCTCGCGCGCCCGCAGCACCCCGGCTCG
CCGCGCCGCCTCCCATCTCTTTGTCGCGCCAGCAGCGGCAGGGGCAGCGGATGTGGCGGC
GGGGAGGGTCTCCTCGGGCAACAGCGGCTGCGGGATACCCAGGCCGGGAGCAGCCGGGGC
CCGGGCAGCCCGGCGCCCCCAGCTCGGGACTCGATCGTCCGAGAAGTCATTCAGAATTCG
AAAGAAGTTCTGAGTTTATTGCAAGAAAAGACCCCTACCTTTAAGCCGGTTCTTGCTATT
ATTCAGGCAGGTGATGATAACTTGATGCAAGAAGTAAACCAGAATTTGGCTGAGGAGGCT
GGTCTGAACATCACCCACATCTGCCTTCCTGCGGAGAGCGGGGAAGATGAGATTATAGAT
GAGATCCTGAAGATTAATGAAGACAGCAGAGTACATGGCCTTGCCCTTCAGATCGCTGAG
ACCTCATTTAGCAACAAAATCCTCAATGCTTTGAAACCAGAAAAAGATGTGGATGGATTA
ACGGATGTCAACCTGGGGAAGTTGGTCCGAGGAGATGCCCATGGGTGTTTTATTTCACCT
GTGGCCAGAGCTGTAATCGAACTTCTTGAAAAGTCAGGTGTCAGCTTAGATGGAAAGAAG
ATCTTGGTAATAGGAGCCCATGGGTCTTTGGAAGCCACCCTACAATGTCTGTTCCAGAGA
AAAGGGTCCATGACAATGAGCTCCCAGTGGAAAACACCTCAGCTTCAAGGCAAGCTACAG
GAGGCTGATATTGTGGTCTTGGGCTCACCCAAGCCAGAAGAGATCCCCCTTTCTTGGATT
CAACCGGGAACTACTGTTTTCAACTGTTCGCATGACTTTCTATCAGGGAAGGCTGCATGC
ATTTCTTCTGGCGTCCATGGTATTAGTCCCATCGCCGAAGATGTGAGTCTCCTTGCTGCT
GCTCTGCGGATTCAGAACATGGTCAGCAGCGGAAGGAGATGGCTCCGTGAGCAGCAGCAC
CGCAGATGGAGACTTCACTGCTTGAAACTTCAGCCTCTGTCCCCTGTACCAAGTGATATC
GAGATTTCGAGAGCGCAGACTCCAAAAGCTGTGGAGATCCTTGCCAAGGAGATAGGATTG
CTTGCAGACGAAATTGAAATCTATGGCAAAAGCAAAGCCAAAGTACGTTTGTCCTTGTTG
GAAAGGTTAAAGGATCAAGCAGATGGAAAATACGTCTTGGTTGCTGGGATCACACCCACC
CCTCTTGGAGAAGGAAAAAGTACAGTTACAATTGGGCTTGTACAGGCATTGACTGCGCAC
CTGAACGTCAACTCCTTTGCCTGTCTCAGGCAGCCTTCTCAAGGACCAACTTTCGGAGTT
AAAGGAGGAGCTGCAGGTGGTGGATATGCCCAGGTCATCCCTATGGAGGAGTTCAACCTT
CACCTTACTGGGGACATCCACGCCATTACTGCTGCCAATAATTTGCTGGCTGCCGCTATC
GACGCAAGGATTTTGCATGAAAACACTCAAACAGATAAGGCCCTGTATAATCGACTGGTT
CCTTCAGTGAATGGTGTTCGAGAATTTTCAAAAATTCAACTTGCTCGGCTGAAAAGACTG
GGAATAAATAAGACTGATCCGAGTGCGCTGACAGAAGAGGAAATGAGGAAATTTGCCCGT
CTTGACATCGACCCCTCCACCATCACATGGCAGAGAGTTGTGGATACCAATGACCGATTT
CTACGGAAAATAACCATTGGGCAGGCGAACACAGAGAAGGGCTGTTCCCGGCAGGCGCAG
TTTGACATCGCAGTGGCCAGTGAAATCATGGCAGTGCTGGCTCTGACCGACAGCCTATCG
GACATGAAGGAGCGGCTGGGAAGAATGGTGGTGGCCAGTGACAGAAATGGACAGCCTGTG
ACAGCAGACGACTTGGGGGTGACAGGTGCTTTGACTGTTCTGATGAAAGACGCGATAAAA
CCAAATCTGATGCAGACCCTAGAAGGGACGCCTGTATTTGTGCATGCTGGCCCCTTTGCC
AACATCGCTCATGGCAACTCTTCAGTGTTGGCTGATAAAATTGCCCTGAAACTGGTTGGG
GAAGGAGGATTTGTGGTGACTGAAGCTGGCTTTGGTGCTGATATTGGCATGGAGAAATTC
TTCAACATCAAGTGCAGAGCTTCTGGTTTGGTGCCCAGCGTTGTGGTTCTGGTGGCGACC
GTGCGGGCTCTGAAGATGCATGGAGGTGGACCGAGCGTAACTGCTGGGGTCCCTCTTAGA
AAGGAATATACCGAAGAGAACCTCCAGCTGGTGGCAGATGGCTGCTGTAACCTGGAGAAG
CAAATTCAGATCGCTCAGCTCTTCGGGGTCCCTGTTGTTGTGGCTCTGAATGTCTTCAAG
ACCGACACCCGCGCAGAGATTGACTTGGTGTGTGAGCTTGCGAAGCGGGCCGGCGCCTTC
AATGCAGTCCCCTGCTATCACTGGTCGATTGGTGGGAAAGGGTCAGTGGACCTGGCTTGG
GCTGTGAGAGAAGCTGCAAGCAAAGAAAGTCGTTTCCAGTTCCTGTATGATGTGCAGCTT
CCAATTGTGGAAAAGATAAGAACCATTGCCCAGTCTGTCTATGGAGCCAAAGATATTGAA
CTCTCTCCAGAAGCACAATCCAAAATAGATCGTTACACGGAACAGGGATTTGGAAATTTG
CCCATCTGCATGGCGAAGACCCACCTCTCCCTGTCTCACCAACCTGACAAGAAAGGCGTA
CCCAAGGGTTTCATTCTACCCATTAGTGACGTCCGGGCCAGCATAGGCGCCGGATTCATT
TACCCATTGGTTGGAACGATGAGCACCATGCCAGGACTGCCAACTCGGCCCTGCTTCTAC
GACATAGATCTTGATACAGAAACAGAGCAGGTTAAAGGCTTGTTCTGA
Protein Properties
Number of Residues 975
Molecular Weight 105227.0
Theoretical pI 7.78
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>Monofunctional C1-tetrahydrofolate synthase, mitochondrial
MSARLPFVLRRLARPQHPGSPRRLPSLCRASSGRGSGCGGGEGLLGQQRLRDTQAGSSRG
PGSPAPPARDSIVREVIQNSKEVLSLLQEKTPTFKPVLAIIQAGDDNLMQEVNQNLAEEA
GLNITHICLPAESGEDEIIDEILKINEDSRVHGLALQIAETSFSNKILNALKPEKDVDGL
TDVNLGKLVRGDAHECFISPVARAVIELLEKSGVSLDGKKILVIGAHGSLEATLQCLFQR
KGSMTMSSQWKTPQLQGKLQEADIVVLGSPKPEEIPLSWIQPGTTVFNCSHDFLSGKAAC
ISSGVHGISPIAEDVSLLAAALRIQNMVSSGRRWLREQQHRRWRLHCLKLQPLSPVPSDI
EISRAQTPKAVEILAKEIGLLADEIEIYGKSKAKVRLSLLERLKDQADGKYVLVAGITPT
PLGEGKSTVTIGLVQALTAHLNVNSFACLRQPSQGPTFGVKGGAAGGGYAQVIPMEEFNL
HLTGDIHAITAANNLLAAAIDARILHENTQTDKALYNRLVPSVNGVREFSKIQLARLKRL
GINKTDPSALTEEEMRKFARLDIDPSTITWQRVVDTNDRFLRKITIGQANTEKGCSRQAQ
FDIAVASEIMAVLALTDSLSDMKERLGRMVVASDRNGQPVTADDLGVTGALTVLMKDAIK
PNLMQTLEGTPVFVHAGPFANIAHGNSSVLADKIALKLVGEGGFVVTEAGFGADIGMEKF
FNIKCRASGLVPSVVVLVATVRALKMHGGGPSVTAGVPLRKEYTEENLQLVADGCCNLEK
QIQIAQLFGVPVVVALNVFKTDTRAEIDLVCELAKRAGAFNAVPCYHWSIGGKGSVDLAW
AVREAASKESRFQFLYDVQLPIVEKIRTIAQSVYGAKDIELSPEAQSKIDRYTEQGFGNL
PICMAKTHLSLSHQPDKKGVPKGFILPISDVRASIGAGFIYPLVGTMSTMPGLPTRPCFY
DIDLDTETEQVKGLF
GenBank ID Protein AAI20039.1
UniProtKB/Swiss-Prot ID Q0VCR7
UniProtKB/Swiss-Prot Entry Name C1TM_BOVIN
PDB IDs Not Available
GenBank Gene ID BC120038
GeneCard ID MTHFD1L
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available