Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00121
Secondary Accession Numbers None
Name Glutaryl-CoA dehydrogenase, mitochondrial
Synonyms Not Available
Gene Name GCDH
Protein Type Enzyme
Biological Properties
General Function Lipid transport and metabolism
Specific Function Catalyzes the oxidative decarboxylation of glutaryl-CoA to crotonyl-CoA and CO(2) in the degradative pathway of L-lysine, L-hydroxylysine, and L-tryptophan metabolism. It uses electron transfer flavoprotein as its electron acceptor (By similarity).
Pathways
  • Amino-acid metabolism
  • Fatty Acid Metabolism
  • Lysine Degradation
  • Lysine degradation.
  • Tryptophan Metabolism
Reactions
Glutaryl-CoA → Crotonoyl-CoA + Carbon dioxide details
Glutaryl-CoA + electron-transfer flavoprotein → Crotonoyl-CoA + Reduced electron-transfer flavoprotein + Carbon dioxide details
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 7
Locus Not Available
SNPs GCDH
Gene Sequence
>1317 bp
ATGGCCCTGAGAGGCGTCTACGCGCAACTACTGAACCGCGGACCCGGCCTACGAGTCTTT
CGTTCATGGAGCTCGGCGACAGCGCAGACCGAGAAAGGCGAGAAGACCCAGAGTCGATCG
GCCAAGCCTTCGCGGCCTGAGTTTGACTGGAGGGATCCACTGTTGCTGGAGGAGCAGCTG
ACAGCAGATGAGATCCTCATCAGGGACACCTTCCGCACCTACTGCCAGGAGCGCCTCATG
CCCCGCATCCTGCTGGCCAATCGCAACGAAGTTTTTCACCGGGAGATCATCTCAGAGATG
GGGGAGCTCGGTATGCTGGGCCCCACCATCCAAGGGTATAGTTGTGCTGGAGTCTCATCG
GTGGCCTACGGGCTCCTAGCCCGAGAGCTGGAGCGAGTGGACAGCGGCTACAGGTCAGCA
ATGAGTGTCCAGTCTTCCCTTGTCATGTACCCTATCTATGCGTATGGCAGCGAGGAGCAG
AAGCAGAAGTACCTGCCCCGGCTGGCCAAGGGGGAGCTGCTGGGCTGCTTTGGGCTCACG
GAGCCCAACCACGGGAGTGACCCTAGTGGCATGGAGACCAGAGCCCGCCACAACCCATCC
AGCAGGAGCTACATCCTCAGTGGGTCCAAGACCTGGATCACCAACTCGCCTGTGGCCGAC
TTGCTGATAGTATGGGCTCGGTGTGAGGATAGCTGCATTCGGGGCTTCCTGCTGGAGAAG
GGGATGCGGGGCCTCTCAACCCCCAGGATTGAGGGCAAGTTCTCTCTGCGGGCATCATCC
ACAGGGATGATTATTATGGATGATGTGGAGGTGCCAGAGGAGAATGTGCTGCCCGGGGTG
TCTGGTCTGGCGGGTCCCTTCGGCTGCCTAAACAATGCCCGCTATGGCATCACATGGGGT
GTGCTTGGAGCTGCTGAATTCTGTTTGCACACGGCCCGGCAGTACACTCTGGACAGGATC
CAGTTTGGTGTCCCACTGGCCAAGAACCAACTGATTCAGAAAAAGCTGGCAGACATGCTC
ACCGAGATCACGTTGGGCCTCCATGCCTGCCTGCAGCTCGGCCGCTTGAAGGATCAAGAC
AAGGCCGCCCCGGAAATGGTCTCTTTGCTGAAGAGGAATAACTGTGGGAAGGCCCTGGAC
ATTGCTCGCCAGGCCCGAGACATGCTTGGGGGGAATGGGATTTCTGATGAGTATCACGTG
ATCCGGCATGTCATGAACCTGGAGTCTGTGAACACCTATGAAGGTACTCATGACATCCAT
GCTCTGATCCTTGGAAGGGCTATCACAGGGATCCAGGCGTTCGTGGCCGGCAAGTGA
Protein Properties
Number of Residues 438
Molecular Weight 48472.0
Theoretical pI 8.14
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • 510-530
Protein Sequence
>Glutaryl-CoA dehydrogenase, mitochondrial
MALRGVYAQLLNRGPGLRVFRSWSSATAQTEKGEKTQSRSAKPSRPEFDWRDPLLLEEQL
TADEILIRDTFRTYCQERLMPRILLANRNEVFHREIISEMGELGMLGPTIQGYSCAGVSS
VAYGLLARELERVDSGYRSAMSVQSSLVMYPIYAYGSEEQKQKYLPRLAKGELLGCFGLT
EPNHGSDPSGMETRARHNPSSRSYILSGSKTWITNSPVADLLIVWARCEDSCIRGFLLEK
GMRGLSTPRIEGKFSLRASSTGMIIMDDVEVPEENVLPGVSGLAGPFGCLNNARYGITWG
VLGAAEFCLHTARQYTLDRIQFGVPLAKNQLIQKKLADMLTEITLGLHACLQLGRLKDQD
KAAPEMVSLLKRNNCGKALDIARQARDMLGGNGISDEYHVIRHVMNLESVNTYEGTHDIH
ALILGRAITGIQAFVAGK
GenBank ID Protein AAI12823.1
UniProtKB/Swiss-Prot ID Q2KHZ9
UniProtKB/Swiss-Prot Entry Name GCDH_BOVIN
PDB IDs
GenBank Gene ID BC112822
GeneCard ID GCDH
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available