Showing Protein tRNA 2'-phosphotransferase 1 (BMDBP00136)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP00136 |
| Secondary Accession Numbers | None |
| Name | tRNA 2'-phosphotransferase 1 |
| Synonyms | Not Available |
| Gene Name | TRPT1 |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Translation, ribosomal structure and biogenesis |
| Specific Function | Catalyzes the last step of tRNA splicing, the transfer of the splice junction 2'-phosphate from ligated tRNA to NAD to produce ADP-ribose 1''-2'' cyclic phosphate. |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 29 |
| Locus | Not Available |
| SNPs | TRPT1 |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 254 |
| Molecular Weight | 27791.0 |
| Theoretical pI | 10.65 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions | Not Available |
| Protein Sequence |
>tRNA 2'-phosphotransferase 1 MNSFGGRRRETAGPKGRRAHRPPQDQDRDVQLSKALSYALRHGALKLGLPMGADGFVPLD ALLQLPQFRSFSAEDVQRVVDTNVKQRFALQPGDPSTGPLIRANQGHSLQVPELELEPLE TPQALPLMLVHGTFRQHWPSILLKGLSCRGRTHIHLAPGLPGDPGVISGMRPNCEVAVFI NGPLALADGIPFFRSTNGVILTPGNADGVLPPKYFKEALQLRPTRKPLSLAGNEEKEHQR DSKHSSRGRGMTQQ |
| External Links | |
| GenBank ID Protein | AAI03211.2 |
| UniProtKB/Swiss-Prot ID | Q3ZBM7 |
| UniProtKB/Swiss-Prot Entry Name | TRPT1_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | DN524407 |
| GeneCard ID | TRPT1 |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |