Identification
BMDB Protein ID BMDBP00143
Secondary Accession Numbers None
Name Insulin-like growth factor 1 receptor
Synonyms Not Available
Gene Name IGF1R
Protein Type Enzyme
Biological Properties
General Function Involved in ATP binding
Specific Function Receptor tyrosine kinase which mediates actions of insulin-like growth factor 1 (IGF1). Binds IGF1 with high affinity and IGF2 and insulin (INS) with a lower affinity. The activated IGF1R is involved in cell growth and survival control. IGF1R is crucial for tumor transformation and survival of malignant cell. Ligand binding activates the receptor kinase, leading to receptor autophosphorylation, and tyrosines phosphorylation of multiple substrates, that function as signaling adapter proteins including, the insulin-receptor substrates (IRS1/2), Shc and 14-3-3 proteins. Phosphorylation of IRSs proteins lead to the activation of two main signaling pathways: the PI3K-AKT/PKB pathway and the Ras-MAPK pathway. The result of activating the MAPK pathway is increased cellular proliferation, whereas activating the PI3K pathway inhibits apoptosis and stimulates protein synthesis. Phosphorylated IRS1 can activate the 85 kDa regulatory subunit of PI3K (PIK3R1), leading to activation of several downstream substrates, including protein AKT/PKB. AKT phosphorylation, in turn, enhances protein synthesis through mTOR activation and triggers the antiapoptotic effects of IGFIR through phosphorylation and inactivation of BAD. In parallel to PI3K-driven signaling, recruitment of Grb2/SOS by phosphorylated IRS1 or Shc leads to recruitment of Ras and activation of the ras-MAPK pathway. In addition to these two main signaling pathways IGF1R signals also through the Janus kinase/signal transducer and activator of transcription pathway (JAK/STAT). Phosphorylation of JAK proteins can lead to phosphorylation/activation of signal transducers and activators of transcription (STAT) proteins. In particular activation of STAT3, may be essential for the transforming activity of IGF1R. The JAK/STAT pathway activates gene transcription and may be responsible for the transforming activity. JNK kinases can also be activated by the IGF1R. IGF1 exerts inhibiting activities on JNK activation via phosphorylation and inhibition of MAP3K5/ASK1, which is able to directly associate with the IGF1R (By similarity). When present in a hybrid receptor with INSR, binds IGF1 (By similarity).
Pathways
  • CXCR4 Signaling Pathway
  • GnRH Signaling Pathway
  • Growth Hormone Signaling Pathway
  • Insulin Signalling
  • Ion Channel and Phorbal Esters Signaling Pathway
  • Leucine Stimulation on Insulin Signaling
Reactions
Insulin receptor substrate 1 → Insulin receptor substrate 1 with Phosphorylation details
Insulin receptor substrate 2 → Insulin receptor substrate 2 with Phosphorylation details
SHC-transforming protein 1 → SHC-transforming protein 1 with phosphorylation details
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 21
Locus Not Available
SNPs IGF1R
Gene Sequence Not Available
Protein Properties
Number of Residues 640
Molecular Weight 72511.0
Theoretical pI 5.08
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • 209-232
Protein Sequence
>Insulin-like growth factor 1 receptor
NAIFVPRPERKRREVMQIANTTMSSRSRNTTVLDTYNITDPEELETEYPFFESRVDNKER
TVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTWEPRPENS
IFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGNYTARIQA
TSLSGNGSWTDPVFFYVQAKTTYENFIHLMIALPIAVLLIVGGLVIMLYVFHRKRNSSRL
GNGVLYASVNPEYFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPE
TRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDL
KSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDF
TVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTHSDVWSFGVVLWEIAT
LAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSVK
DEMEAGFREVSFYYSEENKPPEPEELDLEPENMESVPLDPSASSASLPLPDRHSGHKAEN
GPGPGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC
GenBank ID Protein CAA38724.1
UniProtKB/Swiss-Prot ID Q05688
UniProtKB/Swiss-Prot Entry Name IGF1R_BOVIN
PDB IDs
GenBank Gene ID X54980
GeneCard ID IGF1R
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available