You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00152
Secondary Accession Numbers None
Name Activin receptor type-2B
Synonyms Not Available
Gene Name ACVR2B
Protein Type Enzyme
Biological Properties
General Function Involved in activin receptor activity
Specific Function Transmembrane serine/threonine kinase activin type-2 receptor forming an activin receptor complex with activin type-1 serine/threonine kinase receptors (ACVR1, ACVR1B or ACVR1c). Transduces the activin signal from the cell surface to the cytoplasm and is thus regulating many physiological and pathological processes including neuronal differentiation and neuronal survival, hair follicle development and cycling, FSH production by the pituitary gland, wound healing, extracellular matrix production, immunosuppression and carcinogenesis. Activin is also thought to have a paracrine or autocrine role in follicular development in the ovary. Within the receptor complex, the type-2 receptors act as a primary activin receptors (binds activin-A/INHBA, activin-B/INHBB as well as inhibin-A/INHA-INHBA). The type-1 receptors like ACVR1B act as downstream transducers of activin signals. Activin binds to type-2 receptor at the plasma membrane and activates its serine-threonine kinase. The activated receptor type-2 then phosphorylates and activates the type-1 receptor. Once activated, the type-1 receptor binds and phosphorylates the SMAD proteins SMAD2 and SMAD3, on serine residues of the C-terminal tail. Soon after their association with the activin receptor and subsequent phosphorylation, SMAD2 and SMAD3 are released into the cytoplasm where they interact with the common partner SMAD4. This SMAD complex translocates into the nucleus where it mediates activin-induced transcription. Inhibitory SMAD7, which is recruited to ACVR1B through FKBP1A, can prevent the association of SMAD2 and SMAD3 with the activin receptor complex, thereby blocking the activin signal. Activin signal transduction is also antagonized by the binding to the receptor of inhibin-B via the IGSF1 inhibin coreceptor (By similarity).
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 22
Locus Not Available
SNPs ACVR2B
Gene Sequence
>1539 bp
ATGACGGCGCCCTGGGCGGCCCTCGCCCTCCTTTGGGGATCGCTGTGCGCCGGTTCGGGG
CGCGGGGAGGCCGAGACACGGGAGTGCATCTACTACAACGCCAACTGGGAGCTGGAGCGC
ACCAACCAGAGCGGCCTGGAGCGCTGCGAGGGCGAGCGGGACAAGCGGCTGCACTGCTAC
GCCTCCTGGCGCAACAGCTCGGGCACCATCGAGCTCGTCAAGAAAGGCTGCTGGCTGGAC
GACTTCAACTGCTACGACAGGCAGGAGTGCGTGGCCACCGAGGAGAACCCCCAGGTGTAC
TTCTGCTGCTGCGAAGGCAACTTCTGCAACGAGCGCTTCACCCACCTGCCCGAGGCGGGC
GGCCCAGAAGTCACGTACGAGCCACCCCCGACAGCCCCCACCCTGCTCACTGTGCTGGCC
TACTCGCTGCTGCCCGTCGGGGGCCTCTCCCTCATCGCCCTGCTGGCCTTCTGGATGTAC
CGACATCGCAAGCCCCCCTACGGCCACGCGGACATCCACGAGGACCCTGGACCTCCACCC
CCGTCCCCTCTGGTGGGCCTGAAGCCTCTGCAACTGCTGGAGATCAAGGCTCGGGGGCGC
TTTGGTTGTGTCTGGAAGGCGCAGCTCATGAACGACTTCGTGGCTGTCAAGATCTTCCCA
CTCCAGGACAAGCAGTCGTGGCAGAGTGAGCGGGAGATCTTCAGCACGCCTGGCATGAAG
CACGAGAACCTGCTGCAGTTCATTGCCGCTGAGAAGCGAGGCTCCAGCCTGGAGGCAGAG
CTGTGGCTCATCACGGCCTTCCACGACAAGGGCTCCCTCACGGATTACCTCAAGGGGAAC
ATCATCACATGGAACGAACTGTGTCACGTGGCAGAGACGATGTCTAGAGGCCTCTCATAC
CTACACGAGGATGTGCCCTGGTGCCGGGGCGAGGGCCACAAGCCATCTATTGCCCACAGG
GACTTTAAGAGCAAGAATGTATTGCTGAAGAGTGACCTCACTGCTGTGCTGGCTGACTTT
GGCCTGGCTGTTCGGTTTGAGCCAGGGAAACCTCCGGGGGACACTCACGGGCAGGTGGGC
ACGCGGCGGTACATGGCCCCCGAGGTGCTCGAGGGAGCCATCAACTTCCAGAGAGACGCC
TTTCTGCGCATCGACATGTACGCCATGGGGCTGGTGCTGTGGGAGCTCGTGTCCCGCTGC
AAAGCTGCCGATGGACCTGTGGATGAGTACATGCTGCCTTTTGAGGAGGAGATCGGCCAG
CACCCGTCACTGGAGGAGCTGCAGGAGGTGGTGGTGCACAAGAAGATGCGGCCCGCCATC
AAGGATCACTGGCTGAAACACCCGGGCCTGGCCCAGCTCTGCGTGACCATCGAGGAGTGC
TGGGACCACGATGCAGAGGCTCGCCTGTCTGCGGGCTGTGTGGAGGAGCGAGTGTCCCTG
ATCCGGAGGTCGGTCAACGGCACTACCTCGGACTGTCTTGTCTCCCTGGTGACCTCCGTC
ACCAATGTGGACCTGCCCCCGAAGGAGTCGAGCATCTAA
Protein Properties
Number of Residues 512
Molecular Weight 57569.0
Theoretical pI 5.6
Pfam Domain Function Not Available
Signals
  • 1-18
Transmembrane Regions
  • 138-158
Protein Sequence
>Activin receptor type-2B
MTAPWAALALLWGSLCAGSGRGEAETRECIYYNANWELERTNQSGLERCEGERDKRLHCY
ASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAG
GPEVTYEPPPTAPTLLTVLAYSLLPVGGLSLIALLAFWMYRHRKPPYGHADIHEDPGPPP
PSPLVGLKPLQLLEIKARGRFGCVWKAQLMNDFVAVKIFPLQDKQSWQSEREIFSTPGMK
HENLLQFIAAEKRGSSLEAELWLITAFHDKGSLTDYLKGNIITWNELCHVAETMSRGLSY
LHEDVPWCRGEGHKPSIAHRDFKSKNVLLKSDLTAVLADFGLAVRFEPGKPPGDTHGQVG
TRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELVSRCKAADGPVDEYMLPFEEEIGQ
HPSLEELQEVVVHKKMRPAIKDHWLKHPGLAQLCVTIEECWDHDAEARLSAGCVEERVSL
IRRSVNGTTSDCLVSLVTSVTNVDLPPKESSI
GenBank ID Protein AAC02647.1
UniProtKB/Swiss-Prot ID Q95126
UniProtKB/Swiss-Prot Entry Name AVR2B_BOVIN
PDB IDs
GenBank Gene ID U57707
GeneCard ID ACVR2B
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available