You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00153
Secondary Accession Numbers None
Name Calcium-transporting ATPase type 2C member 1
Synonyms Not Available
Gene Name ATP2C1
Protein Type Enzyme
Biological Properties
General Function Inorganic ion transport and metabolism
Specific Function This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of calcium.
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 1
Locus Not Available
SNPs ATP2C1
Gene Sequence
>2862 bp
ATGGATAATCTGTTGCCTCAGTCAAGATTCTCTTATTTCAAAAAATATCCTATCCATGCA
ATTAGAAAATATTTATCGATGCTGAGAAACCAAAAAGAAGAAGAACAGGTTGCACGTTTT
CAAAAAATTCCTAATGCTGAAAATGAGACAATGATTCCGGTATTGACATCAAAAAAAGCA
AGTGAATTACCAGTCAGTGAAGTTGCAAGCATTCTCCAAGCTGATCTTCAGAATGGTCTA
AACAAATGTGAAGTAAGTCATAGGAGAGCCTTCCATGGCTGGAATGAGTTTGATATCAGT
GAAGATGAGCCACTATGGAAGAAGTATATTTCTCAGTTTAAAAATCCCCTTATTATGCTG
CTTCTGGCTTCTGCAGTCATCAGTGTTTTAATGCATCAGTTTGATGATGCTGTCAGTATC
ACTGTGGCAATACTTATTGTTGTTACGGTCGCCTTCGTTCAGGAATATCGTTCAGAAAAA
TCTCTTGAAGAACTAAGTAAACTTATGCCACCAGAATGCCATTGTGTGCGTGAAGGAAAA
TTGGAGCATACACTTGCACGAGACTTAGTTCCAGGTGATACAGTTTGCCTTTCAGTTGGG
GACAGGGTTCCTGCTGACTTGCGCTTGTTTGAGGCTGTGGATCTTTCTGTTGATGAGTCC
AGCTTGACAGGAGAGACAACACCTTGTTCTAAGGTGACAGCTCCTCAGCCGGCTGCTACT
AATGGAGATCTTGCATCAAGAAGTAACATTGCCTTCATGGGAACACTGGTCAGATGTGGC
AAAGCAAAGGGTATTGTCATTGGAACAGGAGAAAATTCTGAATTCGGAGAAGTTTTTAAA
ATGATGCAAGCAGAAGAAGCACCAAAAACCCCTCTGCAGAAGAGCATGGACCTCTTAGGA
AAACAACTTTCCTTTTACTCCTTTGGTATAATAGGTATCATCATGTTGGTTGGCTGGTTG
CTAGGAAAAGACATATTGGAAATGTTTACTATTAGTGTAAGTTTGGCTGTAGCAGCAATT
CCTGAAGGTCTTCCCATTGTGGTCACAGTGACTCTAGCCCTTGGTGTTATGAGAATGGTG
AAGAAGAGGGCGATTGTGAAAAAACTACCTATTGTTGAAACTCTGGGTTGCTGTAATGTG
ATTTGTTCAGATAAGACTGGAACCCTGACCAAGAATGAAATGACTGTTACCCACATATTT
ACTTCGGATGGCCTGCGTGCTGAGGTTACTGGAGTTGGCTACAATCCATTTGGGGAAGTG
ATTGTTGATGGTGATGTTGTTCATGGATTCTATAACCCATCTGTTAGTAGAATTGTTGAG
GCTGGCTGTGTGTGCAATGATGCTGTAATTAGAAATAACACTCTAATGGGGAAACCAACG
GAAGGAGCCTTAATTGCTCTTGCAATGAAGATGGGTCTTGATGGACTTCAACAGGATTAT
ATCAGAAAAGCTGAATACCCTTTTAGCTCTGAGCAGAAGTGGATGGCTGTTAAGTGTGTG
CACCGAACACAGCAGGACAGACCAGAGATTTGTTTTATGAAGGGTGCTTATGAACAGGTG
ATTAAGTATTGTACTACATATCACAGCAAAGGACAGACCTTGACACTCACCCAGCAGCAG
AGAGATCTGTACCAGCAAGAGAAGGCCCAGATGGGCTCTGCAGGGCTCAGAGTTCTTGCT
TTGGCTTCTGGTCCTGAATTGGGACAACTGACGTTCCTTGGCCTGGTGGGAATCATTGAT
CCTCCTAGAACTGGTGTGAAAGAAGCCGTTACAACACTCATTGCCTCAGGAGTATCAATA
AAAATGATTACTGGAGACTCACAGGAGACTGCAGTTGCCATCGCTAGTCGTCTGGGATTA
TATTCCAAAACCTCCCAGTCAGTCTCAGGAGAAGAAATAGATGCAATGGATGTCCAGCAG
CTTTCACAAATAGTGCCAAAGGTTGCAGTATTTTACAGAGCTAGCCCAAGGCATAAGATG
AAAATTATCAAGTCTCTGCAGAAGAATGGGTCAGTTGTGGCCATGACAGGAGATGGAGTA
AATGATGCAGTTGCTCTGAAGGCTGCAGACATTGGAGTTGCGATGGGTCAGACTGGCACA
GATGTTTGCAAAGAGGCAGCTGACATGATCCTGGTGGATGATGATTTCCAAACCATCATG
TCTGCAATTGAAGAGGGTAAAGGGATTTATAATAACATTAAAAATTTTGTTAGATTCCAG
CTGAGCACGAGTATAGCAGCATTAACTTTAATCTCACTGGCTACATTAATGAACTTTCCC
AATCCTCTCAATGCCATGCAGATTTTGTGGATCAATATTATTATGGATGGACCTCCAGCT
CAGAGCCTTGGAGTAGAACCAGTGGATAAAGATGTCATTCGTAAACCTCCACGCAACTGG
AAAGACAGCATTTTGACCAAAAACCTGATACTTAAAATACTTGTTTCCTCAATAATCATT
GTTTGTGGGACTTTGTTTGTCTTCTGGCGGGAGCTGCGAGACAATGTGATAACACCTCGG
GACACAACAATGACTTTCACGTGCTTTGTGTTTTTTGACATGTTCAATGCACTGAGTTCC
AGATCTCAGACCAAATCTGTGTTTGAGATTGGACTCTGCAGTAATAAAATGTTTTGCTAT
GCAGTTCTTGGATCCATCATGGGACAGTTATTAGTTATTTACTTTCCTCCACTTCAGAAA
GTTTTTCAGACTGAGAGCCTAAGTATACTGGATTTACTGTTTCTTCTGGGTCTCACCTCG
TCAGTGTGCATAGTGGCAGAAATTATCAAGAAGGTTGAAAGGAGCAGAGAGAAGATCCAG
AAGCCTGTTAGCTCGACATCATCGTCTTTTCTTGAAGTATGA
Protein Properties
Number of Residues 953
Molecular Weight 104780.0
Theoretical pI 7.01
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • 105-125
  • 139-157
  • 297-316
  • 329-346
  • 734-753
  • 764-784
  • 805-824
  • 843-862
  • 876-894
  • 910-930
Protein Sequence
>Calcium-transporting ATPase type 2C member 1
MDNLLPQSRFSYFKKYPIHAIRKYLSMLRNQKEEEQVARFQKIPNAENETMIPVLTSKKA
SELPVSEVASILQADLQNGLNKCEVSHRRAFHGWNEFDISEDEPLWKKYISQFKNPLIML
LLASAVISVLMHQFDDAVSITVAILIVVTVAFVQEYRSEKSLEELSKLMPPECHCVREGK
LEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDLSVDESSLTGETTPCSKVTAPQPAAT
NGDLASRSNIAFMGTLVRCGKAKGIVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDLLG
KQLSFYSFGIIGIIMLVGWLLGKDILEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMV
KKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHIFTSDGLRAEVTGVGYNPFGEV
IVDGDVVHGFYNPSVSRIVEAGCVCNDAVIRNNTLMGKPTEGALIALAMKMGLDGLQQDY
IRKAEYPFSSEQKWMAVKCVHRTQQDRPEICFMKGAYEQVIKYCTTYHSKGQTLTLTQQQ
RDLYQQEKAQMGSAGLRVLALASGPELGQLTFLGLVGIIDPPRTGVKEAVTTLIASGVSI
KMITGDSQETAVAIASRLGLYSKTSQSVSGEEIDAMDVQQLSQIVPKVAVFYRASPRHKM
KIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVAMGQTGTDVCKEAADMILVDDDFQTIM
SAIEEGKGIYNNIKNFVRFQLSTSIAALTLISLATLMNFPNPLNAMQILWINIIMDGPPA
QSLGVEPVDKDVIRKPPRNWKDSILTKNLILKILVSSIIIVCGTLFVFWRELRDNVITPR
DTTMTFTCFVFFDMFNALSSRSQTKSVFEIGLCSNKMFCYAVLGSIMGQLLVIYFPPLQK
VFQTESLSILDLLFLLGLTSSVCIVAEIIKKVERSREKIQKPVSSTSSSFLEV
GenBank ID Protein AAF64433.1
UniProtKB/Swiss-Prot ID P57709
UniProtKB/Swiss-Prot Entry Name AT2C1_BOVIN
PDB IDs Not Available
GenBank Gene ID AF230532
GeneCard ID ATP2C1
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available