You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00155
Secondary Accession Numbers None
Name 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3
Synonyms Not Available
Gene Name PFKFB3
Protein Type Enzyme
Biological Properties
General Function Carbohydrate transport and metabolism
Specific Function Synthesis and degradation of fructose 2,6-bisphosphate.
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 13
Locus Not Available
SNPs PFKFB3
Gene Sequence Not Available
Protein Properties
Number of Residues 463
Molecular Weight 53584.0
Theoretical pI 7.66
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3
MPLELTQSRVQKIWIPVDHRPSLPRTCGPKLTNSPTVIVMVGLPARGKTYISKKLTRYLN
WIGVPTKVFNLGEYRRDGVKQYSSYNFFRPDNEEAMKVRKQCALAALRDVKSYLTKEGGQ
IAVFDATNTTRERRHMILHFPKENDFKVFFIESVCDDPTVVASNIMEVKISSPDYKDCNS
RENAMDDFMKRINCYEASYQPLDPDNDDRDLSLIKVIDVGQRFLVNRVQDHIQRRIVYYL
MNIHWQPRTIYLCRHGESKHNLQGKIGGDSGLSSRGRKFANALSKFVEEQNLKDLKVWTS
QLKSTIQTAEALQLPYEQWKALNEIDAGVCEEMTYEEIKDTYPEEYALAEADKYYYRYPT
GESYQDLVQRLEPVIMELERQENVLVICHQAVCVCLLAYFLDKSAEEMPYLKCPLHAVLK
LTPIAYGCRVESIYLNVESVSTHRERSEDAKKGPNPLMRSNSH
GenBank ID Protein AAB34145.2
UniProtKB/Swiss-Prot ID Q28901
UniProtKB/Swiss-Prot Entry Name F263_BOVIN
PDB IDs Not Available
GenBank Gene ID S77845
GeneCard ID PFKFB3
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available