You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00157
Secondary Accession Numbers None
Name Probable phospholipid-transporting ATPase IIB
Synonyms Not Available
Gene Name ATP9B
Protein Type Enzyme
Biological Properties
General Function Inorganic ion transport and metabolism
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 24
Locus Not Available
SNPs ATP9B
Gene Sequence
>3411 bp
ATGGCGGACCAGATCCCTCTGTACCCGGTGCGCAGCGCGGCGGCCGTGGCCGCGGCCAAC
CGTAAACGCGCGGCCTACTTCAGCTCAGCGGGGCCCGGGCCGGGGGCCGACAGGCCCAGC
AGGTACCAGCTGGAGGATGAGTCTGCCCACTTGGATGAAATGCCACTGATGATGTCTGAA
GAGGGCTTTGAGAACGACGAAAGTGATTACCACACTTTACCACGAGCTAGGATCACCCGA
AGAAAGAGAGGCCTGGAGTGGTTTGTCTGTGGGGGATGGAAGTTCCTCTGTACCAGTTGC
TGTGACTGGCTGATAAATATTTGTCAAAGAAAGAGAGAATTGAAAGCTCGTACGGTGTGG
CTTGGATGTCCGGAAAAGTGTGAAGAAAAACATCCCAGAAATTCTATAAAAAATCAGAAA
TATAATATATTTACCTTTATACCTGGGGTTTTATATGAACAATTCAAATTTTTCCTGAAT
CTCTATTTCCTGATAGTATCCTGCTCACAGTTTGTACCAGCACTGAAAATAGGGTATCTC
TACACCTACTGGGCTCCTCTGGGGTTTGTCTTGGCTGTTACTATCATGAGAGAAGCAGTT
GATGAATTTCGGCGTTTCCAGCGAGACAAGGAAGTGAACTCACAACTGTACAGCAAGCTT
ACAGTAAGAGGTAAAGTGCAAGTTAAGAGTTCAGACATACAAGTTGGAGACCTCATCATA
GTGGAAAAGAATCAAAGAATTCCATCGGACATGGTATTTCTTAGGACGTCAGAAAAAGCA
GGTTCGTGTTTTATTCGAACTGATCAACTCGATGGTGAAACTGACTGGAAGCTGAAAGTG
GCGGTGAGCTGCACACAGAGGCTGCCCGCTCTGGGGGACCTTTTTTCTATCAATGCTTAT
GTTTATGCTCAGAAGCCACAACTGGATATTCATAGTTTTGAAGGCACATTTACGAGGGAA
GACAGTGATCCACCTGTTCATGAAAGTCTCAGCATAGAAAATACATTGTGGGCAAGCACT
GTGGTTGCATCAGGTACTGTAATAGGTGTGGTCATCTATACTGGAAAAGAGACTAGAAGT
GTCATGAACACATCAAATCCAAAAAACAAGGTTGGTCTGTTGGATCTTGAACTCAACCAG
CTGACCAAAGCACTATTTCTGGCCTTGGTTGCCCTCTCGGTTGTCATGGTGACCTTGCAG
GGATTTGCAGGCCCCTGGTACCGCAGTCTCTTCCGCTTTCTCCTCCTCTTCTCCTACATC
ATTCCCATAAGTTTGCGTGTGAACCTGGACATGGGCAAGGCTGCCTACGGGTGGATGATC
ATGAGAGACGAGCACATTCCCGGCACCGTGGTCCGGACCAGCACCATCCCGGAGGAGCTG
GGGCGCCTGGTGTACCTGCTGACCGACAAGACAGGAACCCTCACCCAAAACGAGATGGTG
TTTAAGCGGCTGCACCTGGGCACCGTGTCTTACGGGACGGACACGATGGATGAGATCCAG
AACCACCTCGTGAACGCCTACACACAGACGCAGTGTCAGGCTGGCGGAAGCAGCGCTGCT
TCAACTCCTCCAAGGAAAGCCCCGTCGTCAGCGCCCAAGGTGAGGAGGAGCGTGAGCAGC
CGGGTCCATGAGGCCGTGAAGGCTGTCGCCCTGTGTCACAATGTGACGCCCGTGTACGAG
GCCCGCGGTGCAGCTGGCGAGACCGAGGTCGCCGAGGCGGACCAGGATTTCAGTGATGAC
AACCGCACCTACCAGGCCTCCAGCCCTGACGAGGTGGCCCTGGTGCAGTGGACAGAGAGC
GTCGGCCTCACGCTGGTCAGCAGAGACCTCACGTCCATGCAGCTGCGGACCCCCGGCGGC
CAGATCCTCACCTACTGCATCCTTCAGACCTTCCCCTTCACGTCGGAGAGCAAGCGCATG
GGGGTCATCGTCAGGGACGAGTCCACAGCAGAGATCACGTTCTACATGAAGGGCGCCGAC
GTGGCCATGGCCTCCATCGTGCAATACAACGATTGGCTGGAGGAGGAGTGTGGGAACATG
GCCCGCGAAGGCCTGCGCACGCTCGTGGTGGCCAAGAGGGCACTCACGGAGGAGCAGTAC
CAGGACTTCGAGAGCCGCTACAACCAGGCCAAGCTGAGCCTCCACGACCGGACGCTCAAG
GTGGCCGCTGTGGTGGAGAGCCTGGAGCGGGAGATGGAGCTGCTGTGCCTGACGGGCGTG
GAGGACCAGCTGCAGGCAGACGTGAGGCCCACCCTGGAGATGCTGCGCAACGCTGGCATC
AAGATCTGGATGCTGACAGGCGACAAGCTGGAGACCGCCACGTGCATCGCCAAGAGTTCC
CACCTGGTGTCACGAACGCAGGACACGCATGTTTTCAGGCCGGTGACCAGCCGCGGAGAA
GCCCACCTGGAGCTGAATGCCTTTCGAAGGAAACATGACTGCGCACTGGTCATTTCCGGG
GACTCCCTGGAGGTCTGCTTGAAGTACTACGAGCACGAGTTTGTGGAGCTGGCCTGCCAG
TGCCCGGCCGTGGTCTGCTGCCGCTGCTCGCCCACCCAGAAGGCCCACATCGTCAAGCTG
CTGCAGCAACACACAGGCCGCCGCACCTGCGCCATCGGTGACGGAGGGAACGACGTGAGC
ATGATCCAGGCGGCGGACTGCGGGATCGGCATCGAGGGGAAGGAGGGGCGGCAGGCCTCA
CTGGCAGCTGACTTCTCCATCACGCGGTTCAAGCACGTTGGCCGTCTGCTCATGGTGCAC
GGGCGCAGCAGCTACAAGCGCTCGGCGGCACTCGGCCAGTTCGTCATGCACCGGGGCCTC
ATCATCTCCACGATGCAGGCTGTGTTCTCCTCCGTCTTCTACTTTGCATCGGTCCCTCTG
TACCAGGGTTTCCTCATGGTGGGGTACGCAACCGTCTACACCATGTTCCCCGTGTTCTCG
CTGGTGCTGGACCAGGATGTGAAGCCGGAGATGGCCATGCTGTACCCAGAGCTGTACAAG
GACCTCACCAAGGGGCGATCCTTATCCTTCAAGACCTTCCTCGTCTGGGTTCTGATCAGC
ATTTACCAAGGTGGCATCCTCATGTTCGGGGCGCTGGTGCTGTTTGAGTCTGAGTTCGTG
CACGTGGTGGCCATCTCCTTCACGGCGCTGGTGCTCACGGAGCTGCTGATGGTGGCGCTG
ACCGTCAGGACCTGGCACTGGCTCATGGTCGTGGCCCAGCTGCTCAGCCTCGGCTGCTAC
GTGGCCTCGCTGGCTTTCCTCAATGAATATTTTGACGTTGCCTTTATCACGACTGTGACC
TTCGTGTGGAAAGTGTCAGCCATCACAGTGGTCAGCTGCCTCCCTCTCTATGTCCTGAAG
TACTTGAAGCGGAAGCTGTCCCCGCCCAGCTACTCCAAGCTCTCCTCCTAG
Protein Properties
Number of Residues 1136
Molecular Weight 127457.0
Theoretical pI 7.73
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • 146-166
  • 175-195
  • 384-404
  • 409-429
  • 940-960
  • 963-983
  • 1013-1033
  • 1042-1062
  • 1067-1087
  • 1099-1119
Protein Sequence
>Probable phospholipid-transporting ATPase IIB
MADQIPLYPVRSAAAVAAANRKRAAYFSSAGPGPGADRPSRYQLEDESAHLDEMPLMMSE
EGFENDESDYHTLPRARITRRKRGLEWFVCGGWKFLCTSCCDWLINICQRKRELKARTVW
LGCPEKCEEKHPRNSIKNQKYNIFTFIPGVLYEQFKFFLNLYFLIVSCSQFVPALKIGYL
YTYWAPLGFVLAVTIMREAVDEFRRFQRDKEVNSQLYSKLTVRGKVQVKSSDIQVGDLII
VEKNQRIPSDMVFLRTSEKAGSCFIRTDQLDGETDWKLKVAVSCTQRLPALGDLFSINAY
VYAQKPQLDIHSFEGTFTREDSDPPVHESLSIENTLWASTVVASGTVIGVVIYTGKETRS
VMNTSNPKNKVGLLDLELNQLTKALFLALVALSVVMVTLQGFAGPWYRSLFRFLLLFSYI
IPISLRVNLDMGKAAYGWMIMRDEHIPGTVVRTSTIPEELGRLVYLLTDKTGTLTQNEMV
FKRLHLGTVSYGTDTMDEIQNHLVNAYTQTQCQAGGSSAASTPPRKAPSSAPKVRRSVSS
RVHEAVKAVALCHNVTPVYEARGAAGETEVAEADQDFSDDNRTYQASSPDEVALVQWTES
VGLTLVSRDLTSMQLRTPGGQILTYCILQTFPFTSESKRMGVIVRDESTAEITFYMKGAD
VAMASIVQYNDWLEEECGNMAREGLRTLVVAKRALTEEQYQDFESRYNQAKLSLHDRTLK
VAAVVESLEREMELLCLTGVEDQLQADVRPTLEMLRNAGIKIWMLTGDKLETATCIAKSS
HLVSRTQDTHVFRPVTSRGEAHLELNAFRRKHDCALVISGDSLEVCLKYYEHEFVELACQ
CPAVVCCRCSPTQKAHIVKLLQQHTGRRTCAIGDGGNDVSMIQAADCGIGIEGKEGRQAS
LAADFSITRFKHVGRLLMVHGRSSYKRSAALGQFVMHRGLIISTMQAVFSSVFYFASVPL
YQGFLMVGYATVYTMFPVFSLVLDQDVKPEMAMLYPELYKDLTKGRSLSFKTFLVWVLIS
IYQGGILMFGALVLFESEFVHVVAISFTALVLTELLMVALTVRTWHWLMVVAQLLSLGCY
VASLAFLNEYFDVAFITTVTFVWKVSAITVVSCLPLYVLKYLKRKLSPPSYSKLSS
GenBank ID Protein AAI26607.1
UniProtKB/Swiss-Prot ID A1A4J6
UniProtKB/Swiss-Prot Entry Name ATP9B_BOVIN
PDB IDs Not Available
GenBank Gene ID BC126606
GeneCard ID ATP9B
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available