You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00162
Secondary Accession Numbers None
Name 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2
Synonyms Not Available
Gene Name PFKFB2
Protein Type Enzyme
Biological Properties
General Function Carbohydrate transport and metabolism
Specific Function Synthesis and degradation of fructose 2,6-bisphosphate.
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 16
Locus Not Available
SNPs PFKFB2
Gene Sequence
>1596 bp
ATGTCCGGGAATCCTGCCTCTTCCTCAGAACAGAACAACAATAGCTATGAAACCAAAGCA
AGTCTCCGAATATCAGAGAAGAAATGTTCATGGGCATCTTACATGACAAACTCTCCAACC
CTCATCGTTATGATTGGCTTGCCAGCCCGTGGCAAAACCTACGTGTCCAAGAAACTTACA
CGCTACCTCAACTGGATTGGGGTGCCCACCAAAGTGTTTAATCTTGGGGTGTATCGGCGG
CAAGCAGTCAAGTCCTATAAGTCCTATGACTTCTTCCGGCATGACAACGAGGAGGCCATG
AAGATTCGCAAACAGTGTGCCCTGGTGGCACTGAAAGACGTGAAGGCGTATCTCACGGAG
GAGAGCGGGCAGATTGCGGTGTTTGATGCTACCAATACCACTCGAGAGAGGAGGGACTTG
ATTTTGAACTTTGCCGAGGAGAATTCTTTCAAGGTGTTCTTTGTGGAGTCCGTGTGCGAT
GATCCTGATGTCATTGCTGCCAACATCCTGGAGGTAAAGGTGTCGAGCCCCGACTACCCT
GAAAGGAACAGGGAGAATGTGATGGATGACTTCCTAAAGAGGATTGAGTGCTACAAAGTC
ACCTATCAACCCCTTGACCCAGACAGCCATGACAAGGATCTTTCTTTCATCAAGGTGATA
AACGTGGGCCAGAGATTTCTCGTGAACAAAGTCCAGGACTACATCCAGAGCAAGATCGTC
TACTACCTCATGAATATCCACGTCCACCCTCGCACCATCTACCTTTGCCGGCATGGAGAG
AGCGAGTTCAACCTCTTGGGGAAGATTGGGGGTGACTCAGGCCTCTCAGTGCGAGGAAAA
CAGTTTGCCCAGGCTCTAAGGAAGTTTCTGGAGGAACAGGAGATAGCAGACCTCAAAGTG
TGGACGAGCCAGTTGAAAAGGACTATCCAGACCGCAGAATCTCTGGGGGTGACCTACGAG
CAGTGGAAGATTCTGAACGAGATTGATGCTGGCGTGTGCGAGGAGATGACTTACGCGGAG
ATTCAGGAGCAGTATCCGGATGAGTTTGCGCTTCGAGATGAAGAGAAATATCTGTACCGA
TATCCTGGAGGGGAGTCATACCAGGACCTCGTGCAGCGGTTGGAGCCAGTCATCATGGAG
CTGGAGCGCCAGGGCAATGTCCTCGTTATCTCCCACCAGGCTGTCATGCGCTGCCTCCTG
GCCTACTTCTTGGACAAGGGTGCAGATGAGCTACCATACCTGAGGTGCCCTCTCCATACC
ATCTTCAAACTTACTCCTGTGGCCTACGGGTGCAAAGTGGAAACAATTAAACTCAATGTG
GAGGCTGTGAACACGCACCGTGACAAGCCAACTAACAACTTTCCCAAGAGCCAAACCCCT
GTAAGGATGAGAAGGAACAGCTTTACGCCTCTGTCCAGTTCGAATACAATCAGGCGTCCA
AGAAATTACAGTGTTGGGAGCCGGCCCCTCCAGCCCCTCAGCCCGCTCCGTGCCCTGGAC
ACGCAAGAAGGGGCCGACCAGCCGAAGACCCAAGCAGAGACCTCGCGGGCTGCACACAGG
CTCCCGTCTCCAGCGCCCCCCACGTCGCCCTCCTGA
Protein Properties
Number of Residues 531
Molecular Weight 60811.0
Theoretical pI 8.41
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • 86-106
  • 130-150
  • 287-306
  • 319-336
  • 770-789
  • 800-820
  • 841-863
  • 916-935
  • 949-967
  • 983-1003
Protein Sequence
>6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2
MSGNPASSSEQNNNSYETKASLRISEKKCSWASYMTNSPTLIVMIGLPARGKTYVSKKLT
RYLNWIGVPTKVFNLGVYRRQAVKSYKSYDFFRHDNEEAMKIRKQCALVALKDVKAYLTE
ESGQIAVFDATNTTRERRDLILNFAEENSFKVFFVESVCDDPDVIAANILEVKVSSPDYP
ERNRENVMDDFLKRIECYKVTYQPLDPDSHDKDLSFIKVINVGQRFLVNKVQDYIQSKIV
YYLMNIHVHPRTIYLCRHGESEFNLLGKIGGDSGLSVRGKQFAQALRKFLEEQEIADLKV
WTSQLKRTIQTAESLGVTYEQWKILNEIDAGVCEEMTYAEIQEQYPDEFALRDEEKYLYR
YPGGESYQDLVQRLEPVIMELERQGNVLVISHQAVMRCLLAYFLDKGADELPYLRCPLHT
IFKLTPVAYGCKVETIKLNVEAVNTHRDKPTNNFPKSQTPVRMRRNSFTPLSSSNTIRRP
RNYSVGSRPLQPLSPLRALDTQEGADQPKTQAETSRAAHRLPSPAPPTSPS
GenBank ID Protein AAA30523.1
UniProtKB/Swiss-Prot ID P26285
UniProtKB/Swiss-Prot Entry Name F262_BOVIN
PDB IDs
GenBank Gene ID M34241
GeneCard ID PFKFB2
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available