You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00166
Secondary Accession Numbers None
Name Beta-adrenergic receptor kinase 2
Synonyms Not Available
Gene Name GRK3
Protein Type Enzyme
Biological Properties
General Function Involved in ATP binding
Specific Function Specifically phosphorylates the agonist-occupied form of the beta-adrenergic and closely related receptors, probably inducing a desensitization of them.
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 17
Locus Not Available
SNPs GRK3
Gene Sequence
>2067 bp
ATGGCGGACCTGGAGGCCGTGCTGGCCGATGTCAGCTACCTGATGGCGATGGAGAAGAGC
AAGGCGACCCCGGCCGCCCGCGCCAGCAAGAAGATCGTCCTGCCCGAGCCCAGTATCCGG
AGCGTGATGCAGAAGTATCTTGAGGAGAGACACGAAATCACCTTTGACAAGATTTTTAAT
CAGAGAATTGGTTTCTTGCTATTTAAAGATTTTTGTTTGAATGAAATTAATGAAGCTGTA
CCTCAGGTGAAGTTTTATGAAGAGATAAAAGAATATGAAAAGCTTGAGAATGAGGAAGAT
CGCCTTTGTAGAAGTCGACAGATTTATGACACTTACATCATGAAGGAGCTGCTGTCGTGT
TCACATCCATTCTCAAAGCAAGCCGTAGAACACGTACAAAGTCATCTGTCCAAGAAACAA
GTGACATCAACTCTTTTTCAGCCATACATAGAAGAAATTTGTGAAAGTCTCCGAGGCAGC
ATTTTTCAAAAATTCATGGAAAGTGACAAGTTTACTAGATTTTGTCAGTGGAAAAACGTG
GAATTAAATATCCATTTGACCATGAATGATTTCAGCGTGCATCGGATCATTGGACGAGGA
GGATTCGGTGAAGTATACGGTTGCAGGAAAGCAGACACTGGAAAGATGTATGCAATGAAA
TGCTTGGATAAGAAGAGAATCAAGATGAAACAGGGAGAAACCTTAGCCTTAAATGAAAGG
ATCATGTTGTCCCTGGTGAGCACAGGAGATTGCCCTTTCATCGTCTGTATGACCTATGCC
TTCCACACTCCAGATAAACTGTGCTTCATCTTGGATCTGATGAACGGGGGTGACCTGCAC
TATCACCTTTCGCAGCACGGGGTGTTTTCTGAGAAGGAGATGCGGTTTTACGCCACAGAA
ATCATCCTGGGGCTGGAACACATGCACAATCGGTTTGTTGTTTACAGAGACTTGAAGCCC
GCCAATATCCTCCTGGATGAGCACGGACATGTGAGGATATCAGACCTTGGTCTTGCCTGC
GATTTTTCCAAAAAGAAGCCGCACGCGAGCGTGGGCACCCACGGGTACATGGCGCCCGAA
GTTCTGCAGAAGGGGACCGCCTACGACAGCAGTGCCGACTGGTTCTCCCTGGGCTGTATG
CTTTTCAAACTTCTGAGAGGTCACAGCCCTTTCAGACAACATAAAACCAAAGATAAGCAT
GAGATAGACCGAATGACTCTCACCATGAACGTGGAACTTCCAGACGTCTTCTCCCCTGAG
CTCAAGTCCCTTCTGGAAGGCCTGCTTCAGCGAGATGTCAGTAAGCGCCTCGGCTGCCAT
GGAGGCAGCGCACAGGAGCTAAAAACGCACGACTTCTTCAGAGGCATCGACTGGCAGCAC
GTCTACCTGCAGAAGTACCCTCCACCCTTGATCCCTCCCCGAGGGGAAGTCAATGCAGCC
GACGCCTTTGACATCGGCTCATTTGATGAAGAGGATACCAAAGGCATCAAGCTTCTTGAT
TGCGACCAAGAACTCTACAAGAACTTCCCTCTGGTGATCTCTGAGCGCTGGCAGCAGGAA
GTGGCGGAAACAGTTTATGAAGCAGTAAATGCAGACACGGATAAAATCGAGGCCAGGAAG
AGAGCTAAAAATAAGCAGCTTGGCCACGAAGAAGATTACGCCCTGGGAAGAGACTGCATC
GTGCACGGGTACATGCTGAAGCTGGGGAACCCTTTCCTGACCCAGTGGCAGCGCCGCTAT
TTTTACCTCTTTCCGAACAGACTTGAGTGGAGAGGAGAAGGCGAGTCGCGACAAAGTTTA
CTGACAATGGAACAGATTGTGTCCGTGGAAGAAACTCAGATTAAAGACAAAAAGTGCATT
TTGTTGAGAATAAAAGGAGGGAAGCAGTTCGTTTTGCAGTGTGAGAGTGACCCAGAGTTT
GTGCAGTGGAAGAAAGAGCTGACGGAGACATTCATGGAGGCCCAGCGGCTGCTACGGCGA
GCCCCCAAGTTCCTCAACAAATCCCGCTCAGCCGTCGTGGAACTCTCAAAGCCTCCCCTC
TGCCATAGGAACAGCAACGGCCTCTGA
Protein Properties
Number of Residues 688
Molecular Weight 79804.0
Theoretical pI 7.56
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>Beta-adrenergic receptor kinase 2
MADLEAVLADVSYLMAMEKSKATPAARASKKIVLPEPSIRSVMQKYLEERHEITFDKIFN
QRIGFLLFKDFCLNEINEAVPQVKFYEEIKEYEKLENEEDRLCRSRQIYDTYIMKELLSC
SHPFSKQAVEHVQSHLSKKQVTSTLFQPYIEEICESLRGSIFQKFMESDKFTRFCQWKNV
ELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNER
IMLSLVSTGDCPFIVCMTYAFHTPDKLCFILDLMNGGDLHYHLSQHGVFSEKEMRFYATE
IILGLEHMHNRFVVYRDLKPANILLDEHGHVRISDLGLACDFSKKKPHASVGTHGYMAPE
VLQKGTAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTMNVELPDVFSPE
LKSLLEGLLQRDVSKRLGCHGGSAQELKTHDFFRGIDWQHVYLQKYPPPLIPPRGEVNAA
DAFDIGSFDEEDTKGIKLLDCDQELYKNFPLVISERWQQEVAETVYEAVNADTDKIEARK
RAKNKQLGHEEDYALGRDCIVHGYMLKLGNPFLTQWQRRYFYLFPNRLEWRGEGESRQSL
LTMEQIVSVEETQIKDKKCILLRIKGGKQFVLQCESDPEFVQWKKELTETFMEAQRLLRR
APKFLNKSRSAVVELSKPPLCHRNSNGL
GenBank ID Protein AAA30406.1
UniProtKB/Swiss-Prot ID P26818
UniProtKB/Swiss-Prot Entry Name ARBK2_BOVIN
PDB IDs Not Available
GenBank Gene ID M73216
GeneCard ID GRK3
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available